Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01975
Secondary Accession Numbers
  • 7412
Name Tenascin-R
Synonyms
  1. Janusin
  2. Restrictin
  3. TN-R
Gene Name TNR
Protein Type Unknown
Biological Properties
General Function Involved in receptor binding
Specific Function Neural extracellular matrix (ECM) protein involved in interactions with different cells and matrix components. These interactions can influence cellular behavior by either evoking a stable adhesion and differentiation, or repulsion and inhibition of neurite growth. Binding to cell surface gangliosides inhibits RGD-dependent integrin-mediated cell adhesion and results in an inhibition of PTK2 (FAK) phosphorylation and cell detachment. Binding to membrane surface sulfatides results in a oligodendrocyte adhesion and differentiation. Interaction with CNTN1 induces a repulsion of neurons and an inhibition of neurite outgrowth. Interacts with SCN2B may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier. TNR-linked chondroitin sulfate glycosaminoglycans are involved in the interaction with FN1 and mediate inhibition of cell adhesion and neurite outgrowth. The highly regulated addition of sulfated carbohydrate structure may modulate the adhesive properties of TNR over the course of development and during synapse maintenance
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
receptor binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 1q24
SNPs TNR
Gene Sequence
>4077 bp
ATGGGGGCAGATGGGGAAACAGTGGTTCTGAAGAACATGCTCATTGGCGTCAACCTGATC
CTTCTGGGCTCCATGATCAAGCCTTCAGAGTGTCAGCTGGAGGTCACCACAGAAAGGGTC
CAGAGACAGTCAGTGGAGGAGGAGGGAGGCATTGCCAACTACAACACGTCCAGCAAAGAG
CAGCCTGTGGTCTTCAACCACGTGTACAACATTAACGTGCCCTTGGACAACCTCTGCTCC
TCAGGGCTAGAGGCCTCTGCTGAGCAGGAGGTGAGTGCAGAAGACGAGACTCTGGCAGAG
TACATGGGCCAGACCTCAGACCACGAGAGCCAGGTTACCTTTACACACAGGATCAACTTC
CCCAAAAAGGCCTGTCCATGTGCCAGTTCAGCCCAGGTGCTGCAGGAGCTGCTGAGCCGG
ATCGAGATGCTGGAGAGGGAGGTGTCGGTGCTGCGAGACCAGTGCAACGCCAACTGCTGC
CAAGAAAGTGCTGCCACAGGACAACTGGACTATATCCCTCACTGCAGCGGCCACGGCAAC
TTTAGCTTTGAGTCCTGTGGCTGCATCTGCAACGAAGGCTGGTTTGGCAAGAATTGCTCG
GAGCCCTACTGCCCGCTGGGTTGCTCCAGCCGGGGGGTGTGTGTGGATGGCCAGTGCATC
TGTGACAGCGAGTACAGCGGGGATGACTGTTCCGAACTCCGGTGCCCAACAGACTGCAGC
TCCCGGGGGCTCTGCGTGGACGGTGAGTGTGTCTGTGAAGAGCCCTACACTGGCGAGGAC
TGCAGGGAACTGAGGTGCCCTGGGGACTGTTCGGGGAAGGGGAGATGTGCCAACGGTACC
TGTTTATGCGAGGAGGGCTACGTTGGTGAGGACTGCGGCCAGCGGCAGTGTCTGAATGCC
TGCAGTGGGCGAGGACAATGTGAGGAGGGGCTCTGCGTCTGTGAAGAGGGCTACCAGGGC
CCTGACTGCTCAGCAGTTGCCCCTCCAGAGGACTTGCGAGTGGCTGGTATCAGCGACAGG
TCCATTGAGCTGGAATGGGACGGGCCGATGGCAGTGACGGAATATGTGATCTCTTACCAG
CCGACGGCCCTGGGGGGCCTCCAGCTCCAGCAGCGGGTGCCTGGAGATTGGAGTGGTGTC
ACCATCACGGAGCTGGAGCCAGGTCTCACCTACAACATCAGCGTCTACGCTGTCATTAGC
AACATCCTCAGCCTTCCCATCACTGCCAAGGTGGCCACCCATCTCTCCACTCCTCAAGGG
CTACAATTTAAGACGATCACAGAGACCACCGTGGAGGTGCAGTGGGAGCCCTTCTCATTT
TCCTTCGATGGGTGGGAAATCAGCTTCATTCCAAAGAACAATGAAGGGGGAGTGATTGCT
CAGGTCCCCAGCGATGTTACGTCCTTTAACCAGACAGGACTAAAGCCTGGGGAGGAATAC
ATTGTCAATGTGGTGGCTCTGAAAGAACAGGCCCGCAGCCCCCCTACCTCGGCCAGCGTC
TCCACAGTCATTGACGGCCCCACGCAGATCCTGGTTCGCGATGTCTCGGACACCGTGGCT
TTTGTGGAGTGGATTCCCCCTCGAGCCAAAGTCGATTTCATTCTTTTGAAATATGGCCTG
GTGGGCGGGGAAGGTGGGAGGACCACCTTCCGGCTGCAGCCTCCCCTGAGCCAATACTCA
GTGCAGGCCCTGCGGCCTGGCTCCCGATACGAGGTGTCAGTCAGTGCCGTCCGAGGGACC
AACGAGAGCGATTCTGCCACCACTCAGTTCACAACAGAGATCGATGCCCCCAAGAACTTG
CGAGTTGGTTCTCGCACAGCAACCAGCCTTGACCTCGAGTGGGATAACAGTGAAGCCGAA
GTTCAGGAGTACAAGGTTGTGTACATCACCCTGGCGGGTGAGCAATATCATGAGGTACTG
GTCCCCAGGGGCATTGGTCCAACCACCAGGGCCACCCTGACAGATCTGGTACCTGGCACT
GAGTATGGAGTTGGAATATCTGCCGTCATGAACTCACAGCAAAGCGTGCCAGCCACCATG
AATGCCAGGACTGAACTTGACAGTCCCCGAGACCTCATGGTGACAGCCTCCTCGGAGACC
TCCATCTCCCTCATCTGGACCAAGGCCAGTGGCCCCATTGACCACTACCGAATTACCTTT
ACCCCATCCTCTGGGATTGCCTCAGAAGTCACCGTACCCAAGGACAGGACCTCATACACA
CTAACAGATCTAGAGCCTGGGGCAGAGTACATCATTTCCGTCACTGCTGAGAGGGGTCGG
CAGCAGAGCTTGGAGTCCACTGTGGATGCTTTCACAGGCTTCCGTCCCATCTCTCATCTG
CACTTTTCTCATGTGACCTCCTCCAGTGTGAACATCACTTGGAGTGATCCATCTCCCCCA
GCAGACAGACTCATTCTTAACTACAGCCCCAGGGATGAGGAGGAAGAGATGATGGAGGTC
TCCCTGGATGCCACCAAGAGGCATGCTGTCCTGATGGGCCTGCAACCAGCCACAGAGTAT
ATTGTGAACCTTGTGGCTGTCCATGGCACAGTGACCTCTGAGCCCATTGTGGGCTCCATC
ACCACAGGAATTGATCCCCCAAAAGACATCACAATTAGCAATGTGACCAAGGACTCAGTG
ATGGTCTCCTGGAGCCCTCCTGTTGCATCTTTCGATTACTACCGAGTATCATATCGACCC
ACCCAAGTGGGACGACTAGACAGCTCAGTGGTGCCCAACACTGTGACAGAATTCACCATC
ACCAGACTGAACCCAGCTACCGAATACGAAATCAGCCTCAACAGCGTGCGGGGCAGGGAG
GAAAGCGAGCGCATCTGTACTCTTGTGCACACAGCCATGGACAACCCTGTGGATCTGATT
GCTACCAATATCACTCCAACAGAAGCCCTGCTGCAGTGGAAGGCACCAGTGGGTGAGGTG
GAGAACTACGTCATTGTTCTTACACACTTTGCAGTCGCTGGAGAGACCATCCTTGTTGAC
GGAGTCAGTGAGGAATTTCGGCTTGTTGACCTGCTTCCTAGCACCCACTATACTGCCACC
ATGTATGCCACCAATGGACCTCTCACCAGTGGCACCATCAGCACCAACTTTTCTACTCTC
CTGGACCCTCCGGCAAACCTGACAGCCAGTGAAGTCACCAGACAAAGTGCCCTGATCTCC
TGGCAGCCTCCCAGGGCAGAGATTGAAAATTATGTCTTGACCTACAAATCCACCGACGGA
AGCCGCAAGGAGCTGATTGTGGATGCAGAAGACACCTGGATTCGACTGGAGGGCCTGTTG
GAGAACACAGACTACACGGTGCTCCTGCAGGCAGCACAGGACACCACGTGGAGCAGCATC
ACCTCCACCGCTTTCACCACAGGAGGCCGGGTGTTCCCTCATCCCCAAGACTGTGCCCAG
CATTTGATGAATGGAGACACTTTGAGTGGGGTTTACCCCATCTTCCTCAATGGGGAGCTG
AGCCAGAAATTACAAGTGTACTGTGATATGACCACCGACGGGGGCGGCTGGATTGTATTC
CAGAGGCGGCAGAATGGCCAAACTGATTTTTTCCGGAAATGGGCTGATTACCGTGTTGGC
TTCGGGAACGTGGAGGATGAGTTCTGGCTGGGGCTGGACAATATACACAGGATCACATCC
CAGGGCCGCTATGAGCTGCGCGTGGACATGCGGGATGGCCAGGAGGCCGCCTTCGCCTCC
TACGACAGGTTCTCTGTCGAGGACAGCAGAAACCTGTACAAACTCCGCATAGGAAGCTAC
AACGGCACTGCGGGGGACTCCCTCAGCTATCATCAAGGACGCCCTTTCTCCACAGAGGAT
AGAGACAATGATGTTGCAGTGACTAACTGTGCCATGTCGTACAAGGGAGCATGGTGGTAT
AAGAACTGCCACCGGACCAACCTCAATGGGAAGTACGGGGAGTCCAGGCACAGTCAGGGC
ATCAACTGGTACCATTGGAAAGGCCATGAGTTCTCCATCCCCTTTGTGGAAATGAAGATG
CGCCCCTACAACCACCGTCTCATGGCAGGGAGAAAACGGCAGTCCTTACAGTTCTGA
Protein Properties
Number of Residues 1358
Molecular Weight 149546.7
Theoretical pI 4.44
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • None
Protein Sequence
>Tenascin-R
MGADGETVVLKNMLIGVNLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
GenBank ID Protein 1617316
UniProtKB/Swiss-Prot ID Q92752
UniProtKB/Swiss-Prot Entry Name TENR_HUMAN
PDB IDs
GenBank Gene ID X98085
GeneCard ID TNR
GenAtlas ID TNR
HGNC ID HGNC:11953
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [PubMed:19838169 ]
  3. Carnemolla B, Leprini A, Borsi L, Querze G, Urbini S, Zardi L: Human tenascin-R. Complete primary structure, pre-mRNA alternative splicing and gene localization on chromosome 1q23-q24. J Biol Chem. 1996 Apr 5;271(14):8157-60. [PubMed:8626505 ]