Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01990
Secondary Accession Numbers
  • 7428
Name Voltage-dependent L-type calcium channel subunit alpha-1D
Synonyms
  1. Calcium channel, L type, alpha-1 polypeptide, isoform 2
  2. Voltage-gated calcium channel subunit alpha Cav1.3
Gene Name CACNA1D
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin- GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
calcium channel complex
voltage-gated calcium channel complex
Function
ion binding
cation binding
metal ion binding
binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium ion binding
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p14.3
SNPs CACNA1D
Gene Sequence
>6486 bp
ATGATGATGATGATGATGATGAAAAAAATGCAGCATCAACGGCAGCAGCAAGCGGACCAC
GCGAACGAGGCAAACTATGCAAGAGGCACCAGACTTCCTCTTTCTGGTGAAGGACCAACT
TCTCAGCCGAATAGCTCCAAGCAAACTGTCCTGTCTTGGCAAGCTGCAATCGATGCTGCT
AGACAGGCCAAGGCTGCCCAAACTATGAGCACCTCTGCACCCCCACCTGTAGGATCTCTC
TCCCAAAGAAAACGTCAGCAATACGCCAAGAGCAAAAAACAGGGTAACTCGTCCAACAGC
CGACCTGCCCGCGCCCTTTTCTGTTTATCACTCAATAACCCCATCCGAAGAGCCTGCATT
AGTATAGTGGAATGGAAACCATTTGACATATTTATATTATTGGCTATTTTTGCCAATTGT
GTGGCCTTAGCTATTTACATCCCATTCCCTGAAGATGATTCTAATTCAACAAATCATAAC
TTGGAAAAAGTAGAATATGCCTTCCTGATTATTTTTACAGTCGAGACATTTTTGAAGATT
ATAGCGTATGGATTATTGCTACATCCTAATGCTTATGTTAGGAATGGATGGAATTTACTG
GATTTTGTTATAGTAATAGTAGGATTGTTTAGTGTAATTTTGGAACAATTAACCAAAGAA
ACAGAAGGCGGGAACCACTCAAGCGGCAAATCTGGAGGCTTTGATGTCAAAGCCCTCCGT
GCCTTTCGAGTGTTGCGACCACTTCGACTAGTGTCAGGAGTGCCCAGTTTACAAGTTGTC
CTGAACTCCATTATAAAAGCCATGGTTCCCCTCCTTCACATAGCCCTTTTGGTATTATTT
GTAATCATAATCTATGCTATTATAGGATTGGAACTTTTTATTGGAAAAATGCACAAAACA
TGTTTTTTTGCTGACTCAGATATCGTAGCTGAAGAGGACCCAGCTCCATGTGCGTTCTCA
GGGAATGGACGCCAGTGTACTGCCAATGGCACGGAATGTAGGAGTGGCTGGGTTGGCCCG
AACGGAGGCATCACCAACTTTGATAACTTTGCCTTTGCCATGCTTACTGTGTTTCAGTGC
ATCACCATGGAGGGCTGGACAGATGTGCTCTACTGGATGAATGATGCTATGGGATTTGAA
TTGCCCTGGGTGTATTTTGTCAGTCTCGTCATCTTTGGGTCATTTTTCGTACTAAATCTT
GTACTTGGTGTATTGAGCGGAGAATTCTCAAAGGAAAGAGAGAAGGCAAAAGCACGGGGA
GATTTCCAGAAGCTCCGGGAGAAGCAGCAGCTGGAGGAGGATCTAAAGGGCTACTTGGAT
TGGATCACCCAAGCTGAGGACATCGATCCGGAGAATGAGGAAGAAGGAGGAGAGGAAGGC
AAACGAAATACTAGCATGCCCACCAGCGAGACTGAGTCTGTGAACACAGAGAACGTCAGC
GGTGAAGGCGAGAACCGAGGCTGCTGTGGAAGTCTCTGTCAAGCCATCTCAAAATCCAAA
CTCAGCCGACGCTGGCGTCGCTGGAACCGATTCAATCGCAGAAGATGTAGGGCCGCCGTG
AAGTCTGTCACGTTTTACTGGCTGGTTATCGTCCTGGTGTTTCTGAACACCTTAACCATT
TCCTCTGAGCACTACAATCAGCCAGATTGGTTGACACAGATTCAAGATATTGCCAACAAA
GTCCTCTTGGCTCTGTTCACCTGCGAGATGCTGGTAAAAATGTACAGCTTGGGCCTCCAA
GCATATTTCGTCTCTCTTTTCAACCGGTTTGATTGCTTCGTGGTGTGTGGTGGAATCACT
GAGACGATCTTGGTGGAACTGGAAATCATGTCTCCCCTGGGGATCTCTGTGTTTCGGTGT
GTGCGCCTCTTAAGAATCTTCAAAGTGACCAGGCACTGGACTTCCCTGAGCAACTTAGTG
GCATCCTTATTAAACTCCATGAAGTCCATCGCTTCGCTGTTGCTTCTGCTTTTTCTCTTC
ATTATCATCTTTTCCTTGCTTGGGATGCAGCTGTTTGGCGGCAAGTTTAATTTTGATGAA
ACGCAAACCAAGCGGAGCACCTTTGACAATTTCCCTCAAGCACTTCTCACAGTGTTCCAG
ATCCTGACAGGCGAAGACTGGAATGCTGTGATGTACGATGGCATCATGGCTTACGGGGGC
CCATCCTCTTCAGGAATGATCGTCTGCATCTACTTCATCATCCTCTTCATTTGTGGTAAC
TATATTCTACTGAATGTCTTCTTGGCCATCGCTGTAGACAATTTGGCTGATGCTGAAAGT
CTGAACACTGCTCAGAAAGAAGAAGCGGAAGAAAAGGAGAGGAAAAAGATTGCCAGAAAA
GAGAGCCTAGAAAATAAAAAGAACAACAAACCAGAAGTCAACCAGATAGCCAACAGTGAC
AACAAGGTTACAATTGATGACTATAGAGAAGAGGATGAAGACAAGGACCCCTATCCGCCT
TGCGATGTGCCAGTAGGGGAAGAGGAAGAGGAAGAGGAGGAGGATGAACCTGAGGTTCCT
GCCGGACCCCGTCCTCGAAGGATCTCGGAGTTGAACATGAAGGAAAAAATTGCCCCCATC
CCTGAAGGGAGCGCTTTCTTCATTCTTAGCAAGACCAACCCGATCCGCGTAGGCTGCCAC
AAGCTCATCAACCACCACATCTTCACCAACCTCATCCTTGTCTTCATCATGCTGAGCAGC
GCTGCCCTGGCCGCAGAGGACCCCATCCGCAGCCACTCCTTCCGGAACACGATACTGGGT
TACTTTGACTATGCCTTCACAGCCATCTTTACTGTTGAGATCCTGTTGAAGATGACAACT
TTTGGAGCTTTCCTCCACAAAGGGGCCTTCTGCAGGAACTACTTCAATTTGCTGGATATG
CTGGTGGTTGGGGTGTCTCTGGTGTCATTTGGGATTCAATCCAGTGCCATCTCCGTTGTG
AAGATTCTGAGGGTCTTAAGGGTCCTGCGTCCCCTCAGGGCCATCAACAGAGCAAAAGGA
CTTAAGCACGTGGTCCAGTGCGTCTTCGTGGCCATCCGGACCATCGGCAACATCATGATC
GTCACCACCCTCCTGCAGTTCATGTTTGCCTGTATCGGGGTCCAGTTGTTCAAGGGGAAG
TTCTATCGCTGTACGGATGAAGCCAAAAGTAACCCTGAAGAATGCAGGGGACTTTTCATC
CTCTACAAGGATGGGGATGTTGACAGTCCTGTGGTCCGTGAACGGATCTGGCAAAACAGT
GATTTCAACTTCGACAACGTCCTCTCTGCTATGATGGCGCTCTTCACAGTCTCCACGTTT
GAGGGCTGGCCTGCGTTGCTGTATAAAGCCATCGACTCGAATGGAGAGAACATCGGCCCA
ATCTACAACCACCGCGTGGAGATCTCCATCTTCTTCATCATCTACATCATCATTGTAGCT
TTCTTCATGATGAACATCTTTGTGGGCTTTGTCATCGTTACATTTCAGGAACAAGGAGAA
AAAGAGTATAAGAACTGTGAGCTGGACAAAAATCAGCGTCAGTGTGTTGAATACGCCTTG
AAAGCACGTCCCTTGCGGAGATACATCCCCAAAAACCCCTACCAGTACAAGTTCTGGTAC
GTGGTGAACTCTTCGCCTTTCGAATACATGATGTTTGTCCTCATCATGCTCAACACACTC
TGCTTGGCCATGCAGCACTACGAGCAGTCCAAGATGTTCAATGATGCCATGGACATTCTG
AACATGGTCTTCACCGGGGTGTTCACCGTCGAGATGGTTTTGAAAGTCATCGCATTTAAG
CCTAAGGGGTATTTTAGTGACGCCTGGAACACGTTTGACTCCCTCATCGTAATCGGCAGC
ATTATAGACGTGGCCCTCAGCGAAGCAGACCCAACTGAAAGTGAAAATGTCCCTGTCCCA
ACTGCTACACCTGGGAACTCTGAAGAGAGCAATAGAATCTCCATCACCTTTTTCCGTCTT
TTCCGAGTGATGCGATTGGTGAAGCTTCTCAGCAGGGGGGAAGGCATCCGGACATTGCTG
TGGACTTTTATTAAGTCCTTTCAGGCGCTCCCGTATGTGGCCCTCCTCATAGCCATGCTG
TTCTTCATCTATGCGGTCATTGGCATGCAGATGTTTGGGAAAGTTGCCATGAGAGATAAC
AACCAGATCAATAGGAACAATAACTTCCAGACGTTTCCCCAGGCGGTGCTGCTGCTCTTC
AGGTGTGCAACAGGTGAGGCCTGGCAGGAGATCATGCTGGCCTGTCTCCCAGGGAAGCTC
TGTGACCCTGAGTCAGATTACAACCCCGGGGAGGAGTATACATGTGGGAGCAACTTTGCC
ATTGTCTATTTCATCAGTTTTTACATGCTCTGTGCATTTCTGATCATCAATCTGTTTGTG
GCTGTCATCATGGATAATTTCGACTATCTGACCCGGGACTGGTCTATTTTGGGGCCTCAC
CATTTAGATGAATTCAAAAGAATATGGTCAGAATATGACCCTGAGGCAAAGGGAAGGATA
AAACACCTTGATGTGGTCACTCTGCTTCGACGCATCCAGCCTCCCCTGGGGTTTGGGAAG
TTATGTCCACACAGGGTAGCGTGCAAGAGATTAGTTGCCATGAACATGCCTCTCAACAGT
GACGGGACAGTCATGTTTAATGCAACCCTGTTTGCTTTGGTTCGAACGGCTCTTAAGATC
AAGACCGAAGGGAACCTGGAGCAAGCTAATGAAGAACTTCGGGCTGTGATAAAGAAAATT
TGGAAGAAAACCAGCATGAAATTACTTGACCAAGTTGTCCCTCCAGCTGGTGATGATGAG
GTAACCGTGGGGAAGTTCTATGCCACTTTCCTGATACAGGACTACTTTAGGAAATTCAAG
AAACGGAAAGAACAAGGACTGGTGGGAAAGTACCCTGCGAAGAACACCACAATTGCCCTA
CAGGCGGGATTAAGGACACTGCATGACATTGGGCCAGAAATCCGGCGTGCTATATCGTGT
GATTTGCAAGATGACGAGCCTGAGGAAACAAAACGAGAAGAAGAAGATGATGTGTTCAAA
AGAAATGGTGCCCTGCTTGGAAACCATGTCAATCATGTTAATAGTGATAGGAGAGATTCC
CTTCAGCAGACCAATACCACCCACCGTCCCCTGCATGTCCAAAGGCCTTCAATTCCACCT
GCAAGTGATACTGAGAAACCGCTGTTTCCTCCAGCAGGAAATTCGGTGTGTCATAACCAT
CATAACCATAATTCCATAGGAAAGCAAGTTCCCACCTCAACAAATGCCAATCTCAATAAT
GCCAATATGTCCAAAGCTGCCCATGGAAAGCGGCCCAGCATTGGGAACCTTGAGCATGTG
TCTGAAAATGGGCATCATTCTTCCCACAAGCATGACCGGGAGCCTCAGAGAAGGTCCAGT
GTGAAAAGAACCCGCTATTATGAAACTTACATTAGGTCCGACTCAGGAGATGAACAGCTC
CCAACTATTTGCCGGGAAGACCCAGAGATACATGGCTATTTCAGGGACCCCCACTGCTTG
GGGGAGCAGGAGTATTTCAGTAGTGAGGAATGCTACGAGGATGACAGCTCGCCCACCTGG
AGCAGGCAAAACTATGGCTACTACAGCAGATACCCAGGCAGAAACATCGACTCTGAGAGG
CCCCGAGGCTACCATCATCCCCAAGGATTCTTGGAGGACGATGACTCGCCCGTTTGCTAT
GATTCACGGAGATCTCCAAGGAGACGCCTACTACCTCCCACCCCAGCATCCCACCGGAGA
TCCTCCTTCAACTTTGAGTGCCTGCGCCGGCAGAGCAGCCAGGAAGAGGTCCCGTCGTCT
CCCATCTTCCCCCATCGCACGGCCCTGCCTCTGCATCTAATGCAGCAACAGATCATGGCA
GTTGCCGGCCTAGATTCAAGTAAAGCCCAGAAGTACTCACCGAGTCACTCGACCCGGTCG
TGGGCCACCCCTCCAGCAACCCCTCCCTACCGGGACTGGACACCGTGCTACACCCCCCTG
ATCCAAGTGGAGCAGTCAGAGGCCCTGGACCAGGTGAACGGCAGCCTGCCGTCCCTGCAC
CGCAGCTCCTGGTACACAGACGAGCCCGACATCTCCTACCGGACTTTCACACCAGCCAGC
CTGACTGTCCCCAGCAGCTTCCGGAACAAAAACAGCGACAAGCAGAGGAGTGCGGACAGC
TTGGTGGAGGCAGTCCTGATATCCGAAGGCTTGGGACGCTATGCAAGGGACCCAAAATTT
GTGTCAGCAACAAAACACGAAATCGCTGATGCCTGTGACCTCACCATCGACGAGATGGAG
AGTGCAGCCAGCACCCTGCTTAATGGGAACGTGCGTCCCCGAGCCAACGGGGATGTGGGC
CCCCTCTCACACCGGCAGGACTATGAGCTACAGGACTTTGGTCCTGGCTACAGCGACGAA
GAGCCAGACCCTGGGAGGGATGAGGAGGACCTGGCGGATGAAATGATATGCATCACCACC
TTGTAG
Protein Properties
Number of Residues 2161
Molecular Weight 245138.8
Theoretical pI 6.73
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 127-145
  • 164-183
  • 196-214
  • 236-254
  • 274-293
  • 382-406
  • 524-543
  • 559-577
  • 586-604
  • 615-633
  • 653-673
  • 728-752
  • 887-905
  • 922-941
  • 954-972
  • 979-998
  • 1018-1037
  • 1128-1148
  • 1206-1224
  • 1240-1259
  • 1267-1288
  • 1314-1333
  • 1353-1372
  • 1440-1464
Protein Sequence
>Voltage-dependent L-type calcium channel subunit alpha-1D
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTI
SSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIT
ETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGG
PSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARK
ESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVP
AGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSS
AALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDM
LVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMI
VTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNS
DFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVA
FFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWY
VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFK
PKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPTATPGNSEESNRISITFFRL
FRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDN
NQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFA
IVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKI
KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFK
KRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFK
RNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNH
HNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSS
VKRTRYYETYIRSDSGDEQLPTICREDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTW
SRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRR
SSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRS
WATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPAS
LTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEME
SAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITT
L
GenBank ID Protein 192807300
UniProtKB/Swiss-Prot ID Q01668
UniProtKB/Swiss-Prot Entry Name CAC1D_HUMAN
PDB IDs
GenBank Gene ID NM_001128840.1
GeneCard ID CACNA1D
GenAtlas ID CACNA1D
HGNC ID HGNC:1391
References
General References
  1. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  2. Williams ME, Feldman DH, McCue AF, Brenner R, Velicelebi G, Ellis SB, Harpold MM: Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype. Neuron. 1992 Jan;8(1):71-84. [PubMed:1309651 ]
  3. Seino S, Chen L, Seino M, Blondel O, Takeda J, Johnson JH, Bell GI: Cloning of the alpha 1 subunit of a voltage-dependent calcium channel expressed in pancreatic beta cells. Proc Natl Acad Sci U S A. 1992 Jan 15;89(2):584-8. [PubMed:1309948 ]
  4. Yamada Y, Masuda K, Li Q, Ihara Y, Kubota A, Miura T, Nakamura K, Fujii Y, Seino S, Seino Y: The structures of the human calcium channel alpha 1 subunit (CACNL1A2) and beta subunit (CACNLB3) genes. Genomics. 1995 May 20;27(2):312-9. [PubMed:7557998 ]
  5. Oguro-Okano M, Griesmann GE, Wieben ED, Slaymaker SJ, Snutch TP, Lennon VA: Molecular diversity of neuronal-type calcium channels identified in small cell lung carcinoma. Mayo Clin Proc. 1992 Dec;67(12):1150-9. [PubMed:1335101 ]