You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01995
Secondary Accession Numbers
  • 7437
Name Transient receptor potential cation channel subfamily M member 2
Synonyms
  1. Estrogen-responsive element-associated gene 1 protein
  2. LTrpC-2
  3. LTrpC2
  4. Long transient receptor potential channel 2
  5. Transient receptor potential channel 7
  6. TrpC7
Gene Name TRPM2
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Nonselective, voltage-independent cation channel mediating sodium and calcium ion influx in response to oxidative stress. Extracellular calcium passes through the channel and acts from the intracellular side as a positive regulator in channel activation. Activated by ADP-ribose, nicotinamide adenine dinucleotide (NAD(+)), reactive nitrogen species and arachidonic acid. Inactivated by intracellular ATP. Confers susceptibility to cell death following oxidative stress. Isoform 2 does not seem to be regulated by ADPR. Has ADP-ribose pyrophosphatase activity.
Pathways Not Available
Reactions
Adenosine diphosphate ribose + Water → Adenosine monophosphate + D-Ribose 5-phosphate details
GO Classification
Biological Process
response to hydroperoxide
sodium ion transmembrane transport
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
catalytic activity
hydrolase activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Molecular Function
manganese ion transmembrane transporter activity
ADP-ribose diphosphatase activity
sodium channel activity
calcium channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 21
Locus 21q22.3
SNPs TRPM2
Gene Sequence
>4512 bp
ATGGAGCCCTCAGCCCTGAGGAAAGCTGGCTCGGAGCAGGAGGAGGGCTTTGAGGGGCTG
CCCAGAAGGGTCACTGACCTGGGGATGGTCTCCAATCTCCGGCGCAGCAACAGCAGCCTC
TTCAAGAGCTGGAGGCTACAGTGCCCCTTCGGCAACAATGACAAGCAAGAAAGCCTCAGT
TCGTGGATTCCTGAAAACATCAAGAAGAAAGAATGCGTGTATTTTGTGGAAAGTTCCAAA
CTGTCTGATGCTGGGAAGGTGGTGTGTCAGTGTGGCTACACGCATGAGCAGCACTTGGAG
GAGGCTACCAAGCCCCACACCTTCCAGGGCACACAGTGGGACCCAAAGAAACATGTCCAG
GAGATGCCAACCGATGCCTTTGGCGACATCGTCTTCACGGGCCTGAGCCAGAAGGTGAAA
AAGTACGTCCGAGTCTCCCAGGACACGCCCTCCAGCGTGATCTACCACCTCATGACCCAG
CACTGGGGGCTGGACGTCCCCAATCTCTTGATCTCGGTGACCGGGGGGGCCAAGAACTTC
AACATGAAGCCGCGGCTGAAGAGCATTTTCCGCAGAGGCCTGGTCAAGGTGGCTCAGACC
ACAGGGGCCTGGATCATCACAGGGGGGTCCCACACCGGCGTCATGAAGCAGGTAGGCGAG
GCGGTGCGGGACTTCAGCCTGAGCAGCAGCTACAAGGAAGGCGAGCTCATCACCATCGGA
GTCGCCACCTGGGGCACTGTCCACCGCCGCGAGGGCCTGATCCATCCCACGGGCAGCTTC
CCCGCCGAGTACATACTGGATGAGGATGGCCAAGGGAACCTGACCTGCCTAGACAGCAAC
CACTCTCACTTCATCCTCGTGGACGACGGGACCCACGGCCAGTACGGGGTGGAGATTCCT
CTGAGGACCAGGCTGGAGAAGTTCATATCGGAGCAGACCAAGGAAAGAGGAGGTGTGGCC
ATCAAGATCCCCATCGTGTGCGTGGTGCTGGAGGGCGGCCCGGGCACGTTGCACACCATC
GACAACGCCACCACCAACGGCACCCCCTGTGTGGTTGTGGAGGGCTCGGGCCGCGTGGCC
GACGTCATTGCCCAGGTGGCCAACCTGCCTGTCTCGGACATCACTATCTCCCTGATCCAG
CAGAAACTGAGCGTGTTCTTCCAGGAGATGTTTGAGACCTTCACGGAAAGCAGGATTGTC
GAGTGGACCAAAAAGATCCAAGATATTGTCCGGAGGCGGCAGCTGCTGACTGTCTTCCGG
GAAGGCAAGGATGGTCAGCAGGACGTGGATGTGGCCATCTTGCAGGCCTTGCTGAAAGCC
TCACGGAGCCAAGACCACTTTGGCCACGAGAACTGGGACCACCAGCTGAAACTGGCAGTG
GCATGGAATCGCGTGGACATTGCCCGCAGTGAGATCTTCATGGATGAGTGGCAGTGGAAG
CCTTCAGATCTGCACCCCACGATGACAGCTGCACTCATCTCCAACAAGCCTGAGTTTGTG
AAGCTCTTCCTGGAAAACGGGGTGCAGCTGAAGGAGTTTGTCACCTGGGACACCTTGCTC
TACCTGTACGAGAACCTGGACCCCTCCTGCCTGTTCCACAGCAAGCTGCAAAAGGTGCTG
GTGGAGGATCCCGAGCGCCCGGCTTGCGCGCCCGCGGCGCCCCGCCTGCAGATGCACCAC
GTGGCCCAGGTGCTGCGGGAGCTGCTGGGGGACTTCACGCAGCCGCTTTATCCCCGGCCC
CGGCACAACGACCGGCTGCGGCTCCTGCTGCCCGTTCCCCACGTCAAGCTCAACGTGCAG
GGAGTGAGCCTCCGGTCCCTCTACAAGCGTTCCTCAGGCCATGTGACCTTCACCATGGAC
CCCATCCGTGACCTTCTCATTTGGGCCATTGTCCAGAACCGTCGGGAGCTGGCAGGAATC
ATCTGGGCTCAGAGCCAGGACTGCATCGCAGCGGCCTTGGCCTGCAGCAAGATCCTGAAG
GAACTGTCCAAGGAGGAGGAGGACACGGACAGCTCGGAGGAGATGCTGGCGCTGGCGGAG
GAGTATGAGCACAGAGCCATCGGGGTCTTCACCGAGTGCTACCGGAAGGACGAAGAGAGA
GCCCAGAAACTGCTCACCCGCGTGTCCGAGGCCTGGGGGAAGACCACCTGCCTGCAGCTC
GCCCTGGAGGCCAAGGACATGAAGTTTGTGTCTCACGGGGGCATCCAGGCCTTCCTGACC
AAGGTGTGGTGGGGCCAGCTCTCCGTGGACAATGGGCTGTGGCGTGTGACCCTGTGCATG
CTGGCCTTCCCGCTGCTCCTCACCGGCCTCATCTCCTTCAGGGAGAAGAGGCTGCAGGAT
GTGGGCACCCCCGCGGCCCGCGCCCGTGCCTTCTTCACCGCACCCGTGGTGGTCTTCCAC
CTGAACATCCTCTCCTACTTCGCCTTCCTCTGCCTGTTCGCCTACGTGCTCATGGTGGAC
TTCCAGCCTGTGCCCTCCTGGTGCGAGTGTGCCATCTACCTCTGGCTCTTCTCCTTGGTG
TGCGAGGAGATGCGGCAGCTCTTCTATGACCCTGACGAGTGCGGGCTGATGAAGAAGGCA
GCCTTGTACTTCAGTGACTTCTGGAATAAGCTGGACGTCGGCGCAATCTTGCTCTTCGTG
GCAGGGCTGACCTGCAGGCTCATCCCGGCGACGCTGTACCCCGGGCGCGTCATCCTCTCT
CTGGACTTCATCCTGTTCTGCCTCCGGCTCATGCACATTTTTACCATCAGTAAGACGCTG
GGGCCCAAGATCATCATTGTGAAGCGGATGATGAAGGACGTCTTCTTCTTCCTCTTCCTG
CTGGCTGTGTGGGTGGTGTCCTTCGGGGTGGCCAAGCAGGCCATCCTCATCCACAACGAG
CGCCGGGTGGACTGGCTGTTCCGAGGGGCCGTCTACCACTCCTACCTCACCATCTTCGGG
CAGATCCCGGGCTACATCGACGGTGTGAACTTCAACCCGGAGCACTGCAGCCCCAATGGC
ACCGACCCCTACAAGCCTAAGTGCCCCGAGAGCGACGCGACGCAGCAGAGGCCGGCCTTC
CCTGAGTGGCTGACGGTCCTCCTACTCTGCCTCTACCTGCTCTTCACCAACATCCTGCTG
CTCAACCTCCTCATCGCCATGTTCAACTACACCTTCCAGCAGGTGCAGGAGCACACGGAC
CAGATTTGGAAGTTCCAGCGCCATGACCTGATCGAGGAGTACCACGGCCGCCCCGCCGCG
CCGCCCCCCTTCATCCTCCTCAGCCACCTGCAGCTCTTCATCAAGAGGGTGGTCCTGAAG
ACTCCGGCCAAGAGGCACAAGCAGCTCAAGAACAAGCTGGAGAAGAACGAGGAGGCGGCC
CTGCTATCCTGGGAGATCTACCTGAAGGAGAACTACCTCCAGAACCGACAGTTCCAGCAA
AAGCAGCGGCCCGAGCAGAAGATCGAGGACATCAGCAATAAGGTTGACGCCATGGTGGAC
CTGCTGGACCTGGACCCACTGAAGAGGTCGGGCTCCATGGAGCAGAGGTTGGCCTCCCTG
GAGGAGCAGGTGGCCCAGACAGCCCGAGCCCTGCACTGGATCGTGAGGACGCTGCGGGCC
AGCGGCTTCAGCTCGGAGGCGGACGTCCCCACTCTGGCCTCCCAGAAGGCCGCGGAGGAG
CCGGATGCTGAGCCGGGAGGCAGGAAGAAGACGGAGGAGCCGGGCGACAGCTACCACGTG
AATGCCCGGCACCTCCTCTACCCCAACTGCCCTGTCACGCGCTTCCCCGTGCCCAACGAG
AAGGTGCCCTGGGAGACGGAGTTCCTGATCTATGACCCACCCTTTTACACGGCAGAGAGG
AAGGACGCGGCCGCCATGGACCCCATGGGAGACACCCTGGAGCCACTGTCCACGATCCAG
TACAACGTGGTGGATGGCCTGAGGGACCGCCGGAGCTTCCACGGGCCGTACACAGTGCAG
GCCGGGTTGCCCCTGAACCCCATGGGCCGCACAGGACTGCGTGGGCGCGGGAGCCTCAGC
TGCTTCGGACCCAACCACACGCTGTACCCCATGGTCACGCGGTGGAGGCGGAACGAGGAT
GGAGCCATCTGCAGGAAGAGCATAAAGAAGATGCTGGAAGTGCTGGTGGTGAAGCTCCCT
CTCTCCGAGCACTGGGCCCTGCCTGGGGGCTCCCGGGAGCCAGGGGAGATGCTACCTCGG
AAGCTGAAGCGGATCCTCCGGCAGGAGCACTGGCCGTCTTTTGAAAACTTGCTGAAGTGC
GGCATGGAGGTGTACAAAGGCTACATGGATGACCCGAGGAACACGGACAATGCCTGGATC
GAGACGGTGGCCGTCAGCGTCCACTTCCAGGACCAGAATGACGTGGAGCTGAACAGGCTG
AACTCTAACCTGCACGCCTGCGACTCGGGGGCCTCCATCCGATGGCAGGTGGTGGACAGG
CGCATCCCACTCTATGCGAACCACAAGACCCTCCTCCAGAAGGCAGCCGCTGAGTTCGGG
GCTCACTACTGA
Protein Properties
Number of Residues 1503
Molecular Weight 171224.9
Theoretical pI 7.566
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Transient receptor potential cation channel subfamily M member 2
MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLS
SWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQ
EMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNF
NMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIG
VATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVA
DVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR
EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
PSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVL
VEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILK
ELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQL
ALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQD
VGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV
CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNE
RRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAF
PEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAA
PPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQ
KQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRA
SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE
KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQ
AGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLP
LSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWI
ETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
AHY
GenBank ID Protein 3928756
UniProtKB/Swiss-Prot ID O94759
UniProtKB/Swiss-Prot Entry Name TRPM2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB001535
GeneCard ID TRPM2
GenAtlas ID TRPM2
HGNC ID HGNC:12339
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  3. Perraud AL, Fleig A, Dunn CA, Bagley LA, Launay P, Schmitz C, Stokes AJ, Zhu Q, Bessman MJ, Penner R, Kinet JP, Scharenberg AM: ADP-ribose gating of the calcium-permeable LTRPC2 channel revealed by Nudix motif homology. Nature. 2001 May 31;411(6837):595-9. [PubMed:11385575 ]
  4. Nagamine K, Kudoh J, Minoshima S, Kawasaki K, Asakawa S, Ito F, Shimizu N: Molecular cloning of a novel putative Ca2+ channel protein (TRPC7) highly expressed in brain. Genomics. 1998 Nov 15;54(1):124-31. [PubMed:9806837 ]
  5. Wehage E, Eisfeld J, Heiner I, Jungling E, Zitt C, Luckhoff A: Activation of the cation channel long transient receptor potential channel 2 (LTRPC2) by hydrogen peroxide. A splice variant reveals a mode of activation independent of ADP-ribose. J Biol Chem. 2002 Jun 28;277(26):23150-6. Epub 2002 Apr 17. [PubMed:11960981 ]
  6. Zhang W, Chu X, Tong Q, Cheung JY, Conrad K, Masker K, Miller BA: A novel TRPM2 isoform inhibits calcium influx and susceptibility to cell death. J Biol Chem. 2003 May 2;278(18):16222-9. Epub 2003 Feb 19. [PubMed:12594222 ]
  7. Uemura T, Kudoh J, Noda S, Kanba S, Shimizu N: Characterization of human and mouse TRPM2 genes: identification of a novel N-terminal truncated protein specifically expressed in human striatum. Biochem Biophys Res Commun. 2005 Mar 25;328(4):1232-43. [PubMed:15708008 ]
  8. Sano Y, Inamura K, Miyake A, Mochizuki S, Yokoi H, Matsushime H, Furuichi K: Immunocyte Ca2+ influx system mediated by LTRPC2. Science. 2001 Aug 17;293(5533):1327-30. [PubMed:11509734 ]
  9. Hara Y, Wakamori M, Ishii M, Maeno E, Nishida M, Yoshida T, Yamada H, Shimizu S, Mori E, Kudoh J, Shimizu N, Kurose H, Okada Y, Imoto K, Mori Y: LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death. Mol Cell. 2002 Jan;9(1):163-73. [PubMed:11804595 ]