Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02005
Secondary Accession Numbers
  • 7457
Name Vitamin K-dependent protein Z
Synonyms Not Available
Gene Name PROZ
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Appears to assist hemostasis by binding thrombin and promoting its association with phospholipid vesicles
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
endopeptidase activity
serine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
blood coagulation
metabolic process
multicellular organismal process
macromolecule metabolic process
protein metabolic process
proteolysis
regulation of body fluid levels
hemostasis
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 13q34
SNPs PROZ
Gene Sequence
>1203 bp
ATGGCAGGCTGCGTCCCACTGCTCCAGGGCCTGGTCCTGGTCCTCGCCCTCCATCGTGTG
GAGCCCTCAGTATTTCTCCCGGCCTCCAAAGCAAACGACGTTCTGGTGAGGTGGAAGCGT
GCGGGCTCCTATCTTCTGGAAGAACTCTTCGAGGGAAACTTGGAAAAAGAATGTTATGAA
GAAATCTGTGTCTATGAAGAAGCAAGAGAAGTGTTTGAAAATGAAGTAGTCACTGATGAA
TTCTGGAGACGATATAAGGGCGGCTCCCCGTGCATCTCCCAGCCCTGCCTCCACAACGGC
TCTTGCCAGGACAGCATCTGGGGCTACACCTGCACCTGCTCCCCCGGCTATGAGGGCAGC
AACTGCGAGCTGGCTAAAAATGAATGTCACCCAGAGCGGACTGATGGGTGTCAACACTTC
TGCCTCCCAGGACAGGAATCCTACACGTGCAGCTGTGCTCAGGGCTACAGGCTTGGTGAG
GACCACAAACAGTGTGTGCCCCACGACCAGTGTGCCTGCGGGGTGCTGACCTCTGAGAAG
CGTGCACCGGATCTACAGGACCTCCCGTGGCAGGTAAAGTTAACAAATTCCGAAGGAAAA
GACTTCTGTGGTGGTGTTATAATACGGGAAAATTTTGTACTGACAACAGCAAAATGTTCA
CTGTTACACAGGAATATTACTGTAAAAACATATTTTAACAGAACGAGCCAAGACCCGCTG
ATGATCAAGATAACGCACGTCCATGTGCACATGCGGTATGACGCGGACGCGGGGGAGAAT
GACCTGTCACTGCTGGAGCTGGAGTGGCCCATCCAGTGCCCAGGTGCGGGGCTCCCCGTG
TGCACCCCTGAGAAAGACTTCGCTGAGCACCTCCTCATCCCACGCACCAGGGGCCTCCTC
AGCGGCTGGGCACGCAATGGCACTGACCTGGGCAACTCGCTGACCACGCGGCCTGTCACA
CTTGTGGAGGGGGAGGAGTGCGGGCAGGTCCTGAATGTGACTGTCACCACCAGGACCTAC
TGTGAGAGAAGCAGCGTGGCGGCCATGCACTGGATGGATGGAAGTGTGGTCACCAGAGAA
CACAGAGGCTCCTGGTTTCTCACGGGGGTCCTGGGCTCGCAGCCAGTAGGAGGGCAGGCT
CACATGGTCCTTGTCACCAAGGTCTCCAGGTACTCACTCTGGTTTAAACAGATCATGAAC
TAA
Protein Properties
Number of Residues 400
Molecular Weight 44743.6
Theoretical pI 5.87
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Vitamin K-dependent protein Z
MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYE
EICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGS
NCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEK
RAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPL
MIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLL
SGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTRE
HRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P22891
UniProtKB/Swiss-Prot Entry Name PROZ_HUMAN
PDB IDs Not Available
GenBank Gene ID M55670
GeneCard ID PROZ
GenAtlas ID PROZ
HGNC ID HGNC:9460
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  3. Nishimura H, Kawabata S, Kisiel W, Hase S, Ikenaka T, Takao T, Shimonishi Y, Iwanaga S: Identification of a disaccharide (Xyl-Glc) and a trisaccharide (Xyl2-Glc) O-glycosidically linked to a serine residue in the first epidermal growth factor-like domain of human factors VII and IX and protein Z and bovine protein Z. J Biol Chem. 1989 Dec 5;264(34):20320-5. [PubMed:2511201 ]
  4. Iwanaga S, Nishimura H, Kawabata S, Kisiel W, Hase S, Ikenaka T: A new trisaccharide sugar chain linked to a serine residue in the first EGF-like domain of clotting factors VII and IX and protein Z. Adv Exp Med Biol. 1990;281:121-31. [PubMed:2129367 ]
  5. Ichinose A, Takeya H, Espling E, Iwanaga S, Kisiel W, Davie EW: Amino acid sequence of human protein Z, a vitamin K-dependent plasma glycoprotein. Biochem Biophys Res Commun. 1990 Nov 15;172(3):1139-44. [PubMed:2244898 ]
  6. Fujimaki K, Yamazaki T, Taniwaki M, Ichinose A: The gene for human protein Z is localized to chromosome 13 at band q34 and is coded by eight regular exons and one alternative exon. Biochemistry. 1998 May 12;37(19):6838-46. [PubMed:9578570 ]
  7. Sejima H, Hayashi T, Deyashiki Y, Nishioka J, Suzuki K: Primary structure of vitamin K-dependent human protein Z. Biochem Biophys Res Commun. 1990 Sep 14;171(2):661-8. [PubMed:2403355 ]