You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02035
Secondary Accession Numbers
  • 7514
Name Potassium channel subfamily K member 3
Synonyms
  1. Acid-sensitive potassium channel protein TASK-1
  2. TWIK-related acid-sensitive K(+) channel 1
  3. Two pore K(+) channel KT3.1
  4. Two pore potassium channel KT3.1
Gene Name KCNK3
Protein Type Enzyme
Biological Properties
General Function Involved in potassium channel activity
Specific Function pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:2
Locus 2p23
SNPs KCNK3
Gene Sequence
>1185 bp
ATGAAGCGGCAGAACGTGCGCACGCTGGCGCTCATCGTGTGCACCTTCACCTACCTGCTG
GTGGGCGCCGCGGTCTTCGACGCGCTGGAGTCGGAGCCCGAGCTGATCGAGCGGCAGCGG
CTGGAGCTGCGGCAGCAGGAGCTGCGGGCGCGCTACAACCTCAGCCAGGGCGGCTACGAG
GAGCTGGAGCGCGTCGTGCTGCGCCTCAAGCCGCACAAGGCCGGCGTGCAGTGGCGCTTC
GCCGGCTCCTTCTACTTCGCCATCACCGTCATCACCACCATCGGCTACGGGCACGCGGCA
CCCAGCACGGATGGCGGCAAGGTGTTCTGCATGTTCTACGCGCTGCTGGGCATCCCGCTC
ACGCTCGTCATGTTCCAGAGCCTGGGCGAGCGCATCAACACCTTGGTGAGGTACCTGCTG
CACCGCGCCAAGAAGGGGCTGGGCATGCGGCGCGCCGACGTGTCCATGGCCAACATGGTG
CTCATCGGCTTCTTCTCGTGCATCAGCACGCTGTGCATCGGCGCCGCCGCCTTCTCCCAC
TACGAGCACTGGACCTTCTTCCAGGCCTACTACTACTGCTTCATCACCCTCACCACCATC
GGCTTCGGCGACTACGTGGCGCTGCAGAAGGACCAGGCCCTGCAGACGCAGCCGCAGTAC
GTGGCCTTCAGCTTCGTCTACATCCTTACGGGCCTCACGGTCATCGGCGCCTTCCTCAAC
CTCGTGGTGCTGCGCTTCATGACCATGAACGCCGAGGACGAGAAGCGCGACGCCGAGCAC
CGCGCGCTGCTCACGCGCAACGGGCAGGCGGGCGGCGGCGGAGGGGGTGGCAGCGCGCAC
ACTACGGACACCGCCTCATCCACGGCGGCAGCGGGCGGCGGCGGCTTCCGCAACGTCTAC
GCGGAGGTGCTGCACTTCCAGTCCATGTGCTCGTGCCTGTGGTACAAGAGCCGCGAGAAG
CTGCAGTACTCCATCCCCATGATCATCCCGCGGGACCTCTCCACGTCCGACACGTGCGTG
GAGCAGAGCCACTCGTCGCCGGGAGGGGGCGGCCGCTACAGCGACACGCCCTCGCGACGC
TGCCTGTGCAGCGGGGCGCCACGCTCCGCCATCAGCTCGGTGTCCACGGGTCTGCACAGC
CTGTCCACCTTCCGCGGCCTCATGAAGCGCAGGAGCTCCGTGTGA
Protein Properties
Number of Residues 394
Molecular Weight 43517.7
Theoretical pI 9.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 9-29
  • 108-128
  • 159-179
  • 223-243
Protein Sequence
>Potassium channel subfamily K member 3
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O14649
UniProtKB/Swiss-Prot Entry Name KCNK3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF006823
GeneCard ID KCNK3
GenAtlas ID KCNK3
HGNC ID HGNC:6278
References
General References
  1. Duprat F, Lesage F, Fink M, Reyes R, Heurteaux C, Lazdunski M: TASK, a human background K+ channel to sense external pH variations near physiological pH. EMBO J. 1997 Sep 1;16(17):5464-71. [PubMed:9312005 ]
  2. Lopes CM, Gallagher PG, Buck ME, Butler MH, Goldstein SA: Proton block and voltage gating are potassium-dependent in the cardiac leak channel Kcnk3. J Biol Chem. 2000 Jun 2;275(22):16969-78. [PubMed:10748056 ]
  3. Patel AJ, Honore E, Lesage F, Fink M, Romey G, Lazdunski M: Inhalational anesthetics activate two-pore-domain background K+ channels. Nat Neurosci. 1999 May;2(5):422-6. [PubMed:10321245 ]
  4. Ashmole I, Goodwin PA, Stanfield PR: TASK-5, a novel member of the tandem pore K+ channel family. Pflugers Arch. 2001 Sep;442(6):828-33. [PubMed:11680614 ]