Showing Protein Parathyroid hormone-related protein (HMDBP02119)

• 7601

1. Osteostatin
2. PLP
3. PTH-rP
4. PTHrP
5. PTHrP[1-36]
6. PTHrP[107-139]
7. PTHrP[38-94]
8. Parathyroid hormone-like protein

1. Nucleus
2. Cytoplasm
3. Secreted

>531 bp
ATGCAGCGGAGACTGGTTCAGCAGTGGAGCGTCGCGGTGTTCCTGCTGAGCTACGCGGTG
CCCTCCTGCGGGCGCTCGGTGGAGGGTCTCAGCCGCCGCCTCAAAAGAGCTGTGTCTGAA
CATCAGCTCCTCCATGACAAGGGGAAGTCCATCCAAGATTTACGGCGACGATTCTTCCTT
CACCATCTGATCGCAGAAATCCACACAGCTGAAATCAGAGCTACCTCGGAGGTGTCCCCT
AACTCCAAGCCCTCTCCCAACACAAAGAACCACCCCGTCCGATTTGGGTCTGATGATGAG
GGCAGATACCTAACTCAGGAAACTAACAAGGTGGAGACGTACAAAGAGCAGCCGCTCAAG
ACACCTGGGAAGAAAAAGAAAGGCAAGCCCGGGAAACGCAAGGAGCAGGAAAAGAAAAAA
CGGCGAACTCGCTCTGCCTGGTTAGACTCTGGAGTGACTGGGAGTGGGCTAGAAGGGGAC
CACCTGTCTGACACCTCCACAACGTCGCTGGAGCTCGATTCACGGAGGCAT

• Parathyroid (PF01279 )

• 1-24

• None

>Parathyroid hormone-related protein
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH

• 1BZG

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
3. Suva LJ, Winslow GA, Wettenhall RE, Hammonds RG, Moseley JM, Diefenbach-Jagger H, Rodda CP, Kemp BE, Rodriguez H, Chen EY, et al.: A parathyroid hormone-related protein implicated in malignant hypercalcemia: cloning and expression. Science. 1987 Aug 21;237(4817):893-6. [PubMed:3616618 ]
4. Mangin M, Webb AC, Dreyer BE, Posillico JT, Ikeda K, Weir EC, Stewart AF, Bander NH, Milstone L, Barton DE, et al.: Identification of a cDNA encoding a parathyroid hormone-like peptide from a human tumor associated with humoral hypercalcemia of malignancy. Proc Natl Acad Sci U S A. 1988 Jan;85(2):597-601. [PubMed:2829195 ]
5. Yasuda T, Banville D, Hendy GN, Goltzman D: Characterization of the human parathyroid hormone-like peptide gene. Functional and evolutionary aspects. J Biol Chem. 1989 May 5;264(13):7720-5. [PubMed:2708388 ]
6. Thiede MA, Strewler GJ, Nissenson RA, Rosenblatt M, Rodan GA: Human renal carcinoma expresses two messages encoding a parathyroid hormone-like peptide: evidence for the alternative splicing of a single-copy gene. Proc Natl Acad Sci U S A. 1988 Jul;85(13):4605-9. [PubMed:3290897 ]
7. Suva LJ, Mather KA, Gillespie MT, Webb GC, Ng KW, Winslow GA, Wood WI, Martin TJ, Hudson PJ: Structure of the 5' flanking region of the gene encoding human parathyroid-hormone-related protein (PTHrP). Gene. 1989 Apr 15;77(1):95-105. [PubMed:2744490 ]
8. Moseley JM, Kubota M, Diefenbach-Jagger H, Wettenhall RE, Kemp BE, Suva LJ, Rodda CP, Ebeling PR, Hudson PJ, Zajac JD, et al.: Parathyroid hormone-related protein purified from a human lung cancer cell line. Proc Natl Acad Sci U S A. 1987 Jul;84(14):5048-52. [PubMed:2885845 ]
9. Mangin M, Ikeda K, Dreyer BE, Broadus AE: Isolation and characterization of the human parathyroid hormone-like peptide gene. Proc Natl Acad Sci U S A. 1989 Apr;86(7):2408-12. [PubMed:2928340 ]
10. Fenton AJ, Kemp BE, Kent GN, Moseley JM, Zheng MH, Rowe DJ, Britto JM, Martin TJ, Nicholson GC: A carboxyl-terminal peptide from the parathyroid hormone-related protein inhibits bone resorption by osteoclasts. Endocrinology. 1991 Oct;129(4):1762-8. [PubMed:1915066 ]
11. Fenton AJ, Kemp BE, Hammonds RG Jr, Mitchelhill K, Moseley JM, Martin TJ, Nicholson GC: A potent inhibitor of osteoclastic bone resorption within a highly conserved pentapeptide region of parathyroid hormone-related protein; PTHrP[107-111]. Endocrinology. 1991 Dec;129(6):3424-6. [PubMed:1954916 ]
12. Martinez ME, Garcia-Ocana A, Sanchez M, Medina S, del Campo T, Valin A, Sanchez-Cabezudo MJ, Esbrit P: C-terminal parathyroid hormone-related protein inhibits proliferation and differentiation of human osteoblast-like cells. J Bone Miner Res. 1997 May;12(5):778-85. [PubMed:9144344 ]
13. Cornish J, Callon KE, Nicholson GC, Reid IR: Parathyroid hormone-related protein-(107-139) inhibits bone resorption in vivo. Endocrinology. 1997 Mar;138(3):1299-304. [PubMed:9048639 ]
14. Jans DA, Thomas RJ, Gillespie MT: Parathyroid hormone-related protein (PTHrP): a nucleocytoplasmic shuttling protein with distinct paracrine and intracrine roles. Vitam Horm. 2003;66:345-84. [PubMed:12852260 ]
15. Lam MH, Hu W, Xiao CY, Gillespie MT, Jans DA: Molecular dissection of the importin beta1-recognized nuclear targeting signal of parathyroid hormone-related protein. Biochem Biophys Res Commun. 2001 Mar 30;282(2):629-34. [PubMed:11401507 ]
16. Fiaschi-Taesch NM, Stewart AF: Minireview: parathyroid hormone-related protein as an intracrine factor--trafficking mechanisms and functional consequences. Endocrinology. 2003 Feb;144(2):407-11. [PubMed:12538599 ]
17. Weidler M, Marx UC, Seidel G, Schafer W, Hoffmann E, Esswein A, Rosch P: The structure of human parathyroid hormone-related protein(1-34) in near-physiological solution. FEBS Lett. 1999 Feb 12;444(2-3):239-44. [PubMed:10050767 ]
18. Cingolani G, Bednenko J, Gillespie MT, Gerace L: Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta. Mol Cell. 2002 Dec;10(6):1345-53. [PubMed:12504010 ]