You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02132
Secondary Accession Numbers
  • 7614
Name P-selectin
Synonyms
  1. CD62 antigen-like family member P
  2. CD62P antigen
  3. GMP-140
  4. Granule membrane protein 140
  5. LECAM3
  6. Leukocyte-endothelial cell adhesion molecule 3
  7. PADGEM
  8. Platelet activation dependent granule-external membrane protein
Gene Name SELP
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with PSGL1
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
binding
Process
cell adhesion
cellular process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q22-q25
SNPs SELP
Gene Sequence
>2493 bp
ATGGCCAACTGCCAAATAGCCATCTTGTACCAGAGATTCCAGAGAGTGGTCTTTGGAATT
TCCCAACTCCTTTGCTTCAGTGCCCTGATCTCTGAACTAACAAACCAGAAAGAAGTGGCA
GCATGGACTTATCATTACAGCACAAAAGCATACTCATGGAATATTTCCCGTAAATACTGC
CAGAATCGCTACACAGACTTAGTGGCCATCCAGAATAAAAATGAAATTGATTACCTCAAT
AAGGTCCTACCCTACTACAGCTCCTACTACTGGATTGGGATCCGAAAGAACAATAAGACA
TGGACATGGGTGGGAACCAAAAAGGCTCTCACCAACGAGGCTGAGAACTGGGCTGATAAT
GAACCTAACAACAAAAGGAACAACGAGGACTGCGTGGAGATATACATCAAGAGTCCGTCA
GCCCCTGGCAAGTGGAATGATGAGCACTGCTTGAAGAAAAAGCACGCATTGTGTTACACA
GCCTCCTGCCAGGACATGTCCTGCAGCAAACAAGGAGAGTGCCTCGAGACCATCGGGAAC
TACACCTGCTCCTGTTACCCTGGATTCTATGGGCCAGAATGTGAATACGTGAGAGAGTGT
GGAGAACTTGAGCTCCCTCAACACGTGCTCATGAACTGCAGCCACCCTCTGGGAAACTTC
TCTTTTAACTCGCAGTGCAGCTTCCACTGCACTGACGGGTACCAAGTAAATGGGCCCAGC
AAGCTGGAATGCTTGGCTTCTGGAATCTGGACAAATAAGCCTCCACAGTGTTTAGCTGCC
CAGTGCCCACCCCTGAAGATTCCTGAACGAGGAAACATGACCTGCCTTCATTCTGCAAAA
GCATTCCAGCATCAGTCTAGCTGCAGCTTCAGTTGTGAAGAGGGATTTGCATTAGTTGGA
CCGGAAGTGGTGCAATGCACAGCCTCGGGGGTATGGACAGCCCCAGCCCCAGTGTGTAAA
GCTGTGCAGTGTCAGCACCTGGAAGCCCCCAGTGAAGGAACCATGGACTGTGTTCATCCG
CTCACTGCTTTTGCCTATGGCTCCAGCTGTAAATTTGAGTGCCAGCCCGGCTACAGAGTG
AGGGGCTTGGACATGCTCCGCTGCATTGACTCTGGACACTGGTCTGCACCCTTGCCAACC
TGTGAGGCTATTTCGTGTGAGCCGCTGGAGAGTCCTGTCCACGGAAGCATGGATTGCTCT
CCATCCTTGAGAGCGTTTCAGTATGACACCAACTGTAGCTTCCGCTGTGCTGAAGGTTTC
ATGCTGAGAGGAGCCGATATAGTTCGGTGTGATAACTTGGGACAGTGGACAGCACCAGCC
CCAGTCTGTCAAGCTTTGCAGTGCCAGGATCTCCCAGTTCCAAATGAGGCCCGGGTGAAC
TGCTCCCACCCCTTCGGTGCCTTTAGGTACCAGTCAGTCTGCAGCTTCACCTGCAATGAA
GGCTTGCTCCTGGTGGGAGCAAGTGTGCTACAGTGCTTGGCTACTGGAAACTGGAATTCT
GTTCCTCCAGAATGCCAAGCCATTCCCTGCACACCTTTGCTAAGCCCTCAGAATGGAACA
ATGACCTGTGTTCAACCTCTTGGAAGTTCCAGTTATAAATCCACATGTCAATTCATCTGT
GACGAGGGATATTCTTTGTCTGGACCAGAAAGATTGGATTGTACTCGATCGGGACGCTGG
ACAGACTCCCCACCAATGTGTGAAGCCATCAAGTGCCCAGAACTCTTTGCCCCAGAGCAG
GGCAGCCTGGATTGTTCTGACACTCGTGGAGAATTCAATGTTGGCTCCACCTGCCATTTC
TCTTGTAACAACGGCTTTAAGCTGGAGGGGCCCAATAATGTGGAATGCACAACTTCTGGA
AGATGGTCAGCTACTCCACCAACCTGCAAAGGCATAGCATCACTTCCTACTCCAGGGGTG
CAATGTCCAGCCCTCACCACTCCTGGGCAGGGAACCATGTACTGTAGGCATCATCCGGGA
ACCTTTGGTTTTAATACCACTTGTTACTTTGGCTGCAACGCTGGATTCACACTCATAGGA
GACAGCACTCTCAGCTGCAGACCTTCAGGACAATGGACAGCAGTAACTCCAGCATGCAGA
GCTGTGAAATGCTCAGAACTACATGTTAATAAGCCAATAGCGATGAACTGCTCCAACCTC
TGGGGAAACTTCAGTTATGGATCAATCTGCTCTTTCCATTGTCTAGAGGGCCAGTTACTT
AATGGCTCTGCACAAACAGCATGCCAAGAGAATGGCCACTGGTCAACTACCGTGCCAACC
TGCCAAGCAGGACCATTGACTATCCAGGAAGCCCTGACTTACTTTGGTGGAGCGGTGGCT
TCTACGATAGGTCTGATAATGGGTGGGACGCTCCTGGCTTTGCTAAGAAAGCGTTTCAGA
CAAAAAGATGATGGGAAATGCCCCTTGAATCCTCACAGCCACCTAGGAACATATGGAGTT
TTTACAAACGCTGCATTTGACCCGAGTCCTTAA
Protein Properties
Number of Residues 830
Molecular Weight 90833.1
Theoretical pI 6.57
Pfam Domain Function
Signals
  • 1-41
Transmembrane Regions
  • 772-795
Protein Sequence
>P-selectin
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
GenBank ID Protein 22771014
UniProtKB/Swiss-Prot ID P16109
UniProtKB/Swiss-Prot Entry Name LYAM3_HUMAN
PDB IDs
GenBank Gene ID AF542391
GeneCard ID SELP
GenAtlas ID SELP
HGNC ID HGNC:10721
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  3. Lewandrowski U, Moebius J, Walter U, Sickmann A: Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach. Mol Cell Proteomics. 2006 Feb;5(2):226-33. Epub 2005 Oct 31. [PubMed:16263699 ]
  4. Sako D, Comess KM, Barone KM, Camphausen RT, Cumming DA, Shaw GD: A sulfated peptide segment at the amino terminus of PSGL-1 is critical for P-selectin binding. Cell. 1995 Oct 20;83(2):323-31. [PubMed:7585949 ]
  5. Pouyani T, Seed B: PSGL-1 recognition of P-selectin is controlled by a tyrosine sulfation consensus at the PSGL-1 amino terminus. Cell. 1995 Oct 20;83(2):333-43. [PubMed:7585950 ]
  6. Wilkins PP, Moore KL, McEver RP, Cummings RD: Tyrosine sulfation of P-selectin glycoprotein ligand-1 is required for high affinity binding to P-selectin. J Biol Chem. 1995 Sep 29;270(39):22677-80. [PubMed:7559387 ]
  7. Somers WS, Tang J, Shaw GD, Camphausen RT: Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. Cell. 2000 Oct 27;103(3):467-79. [PubMed:11081633 ]
  8. Johnston GI, Cook RG, McEver RP: Cloning of GMP-140, a granule membrane protein of platelets and endothelium: sequence similarity to proteins involved in cell adhesion and inflammation. Cell. 1989 Mar 24;56(6):1033-44. [PubMed:2466574 ]
  9. Fujimoto T, Stroud E, Whatley RE, Prescott SM, Muszbek L, Laposata M, McEver RP: P-selectin is acylated with palmitic acid and stearic acid at cysteine 766 through a thioester linkage. J Biol Chem. 1993 May 25;268(15):11394-400. [PubMed:7684381 ]
  10. Florian V, Schluter T, Bohnensack R: A new member of the sorting nexin family interacts with the C-terminus of P-selectin. Biochem Biophys Res Commun. 2001 Mar 9;281(4):1045-50. [PubMed:11237770 ]
  11. Knauth P, Schluter T, Czubayko M, Kirsch C, Florian V, Schreckenberger S, Hahn H, Bohnensack R: Functions of sorting nexin 17 domains and recognition motif for P-selectin trafficking. J Mol Biol. 2005 Apr 8;347(4):813-25. [PubMed:15769472 ]
  12. Freedman SJ, Sanford DG, Bachovchin WW, Furie BC, Baleja JD, Furie B: Structure and function of the epidermal growth factor domain of P-selectin. Biochemistry. 1996 Oct 29;35(43):13733-44. [PubMed:8901515 ]
  13. Bajorath J, Stenkamp R, Aruffo A: Knowledge-based model building of proteins: concepts and examples. Protein Sci. 1993 Nov;2(11):1798-810. [PubMed:7505680 ]
  14. Herrmann SM, Ricard S, Nicaud V, Mallet C, Evans A, Ruidavets JB, Arveiler D, Luc G, Cambien F: The P-selectin gene is highly polymorphic: reduced frequency of the Pro715 allele carriers in patients with myocardial infarction. Hum Mol Genet. 1998 Aug;7(8):1277-84. [PubMed:9668170 ]
  15. Zee RY, Cook NR, Cheng S, Reynolds R, Erlich HA, Lindpaintner K, Ridker PM: Polymorphism in the P-selectin and interleukin-4 genes as determinants of stroke: a population-based, prospective genetic analysis. Hum Mol Genet. 2004 Feb 15;13(4):389-96. Epub 2003 Dec 17. [PubMed:14681304 ]