You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02139
Secondary Accession Numbers
  • 7622
Name 5,6-dihydroxyindole-2-carboxylic acid oxidase
Synonyms
  1. Catalase B
  2. DHICA oxidase
  3. Glycoprotein 75
  4. Melanoma antigen gp75
  5. TRP
  6. TRP-1
  7. TRP1
  8. Tyrosinase-related protein 1
Gene Name TYRP1
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized
Pathways
  • Degradation of Superoxides
Reactions Not Available
GO Classification
Component
membrane
cell part
vesicle membrane
cytoplasmic vesicle membrane
melanosome membrane
organelle membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen
monooxygenase activity
oxidoreductase activity
copper ion binding
Process
metabolic process
secondary metabolic process
melanin metabolic process
melanin biosynthetic process
oxidation reduction
Cellular Location
  1. Melanosome membrane
  2. Single-pass type I membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:9
Locus 9p23
SNPs TYRP1
Gene Sequence
>1614 bp
ATGAGTGCTCCTAAACTCCTCTCTCTGGGCTGTATCTTCTTCCCCTTGCTACTTTTTCAG
CAGGCCCGGGCTCAATTCCCAAGACAGTGTGCCACTGTTGAGGCTTTGAGAAGTGGTATG
TGTTGCCCAGACCTGTCCCCTGTGTCTGGGCCTGGGACAGACCGCTGTGGCTCATCATCA
GGGAGGGGCAGATGTGAGGCAGTGACTGCAGACTCCCGGCCCCACAGCCCTCAGTATCCC
CATGATGGCAGAGATGATCGGGAGGTCTGGCCCTTGCGCTTCTTCAATAGGACATGTCAC
TGCAACGGCAATTTCTCAGGACACAACTGTGGGACGTGCCGTCCTGGCTGGAGAGGAGCT
GCCTGTGACCAGAGGGTTCTCATAGTCAGGAGAAATCTTCTGGACTTAAGTAAAGAAGAA
AAGAACCACTTTGTCCGGGCCCTGGATATGGCAAAGCGCACAACTCACCCTTTATTTGTC
ATTGCCACCAGGAGATCAGAAGAAATACTGGGGCCAGATGGCAACACGCCACAATTTGAG
AACATTTCCATTTATAACTACTTTGTTTGGACACACTATTACTCAGTCAAAAAGACTTTC
CTTGGGGTAGGACAGGAAAGCTTTGGTGAAGTGGATTTCTCTCATGAGGGACCAGCTTTT
CTCACATGGCACAGGTACCACCTCCTGCGTCTGGAGAAAGACATGCAGGAAATGTTGCAA
GAGCCTTCTTTCTCCCTTCCTTACTGGAATTTTGCAACGGGGAAAAATGTCTGTGATATC
TGCACGGATGACTTGATGGGATCCAGAAGCAACTTTGATTCCACTCTAATAAGCCCAAAC
TCTGTCTTTTCTCAATGGCGAGTGGTCTGTGACTCCTTGGAAGATTATGATACCCTGGGA
ACACTTTGTAACAGCACCGAGGATGGGCCAATTAGGAGAAATCCAGCTGGAAATGTGGCC
AGACCAATGGTGCAACGTCTTCCTGAACCACAGGATGTCGCTCAGTGCTTGGAAGTTGGT
TTATTTGACACGCCTCCTTTTTATTCCAACTCTACAAACAGTTTCCGAAACACAGTGGAA
GGTTACAGTGACCCCACGGGAAAGTATGACCCTGCTGTTCGAAGTCTTCACAATTTGGCT
CATCTATTCCTGAATGGAACAGGGGGACAAACCCATTTGTCTCCAAATGATCCTATTTTT
GTCCTCCTGCACACCTTCACAGATGCAGTCTTTGATGAATGGCTGAGGAGATACAATGCT
GATATATCCACATTTCCATTGGAAAATGCCCCTATTGGACATAATAGACAATACAACATG
GTGCCATTCTGGCCCCCAGTCACCAACACAGAAATGTTTGTTACTGCTCCAGACAACCTG
GGATACACTTATGAAATTCAATGGCCAAGTCGGGAGTTTAGTGTACCTGAGATAATTGCC
ATAGCAGTAGTTGGCGCTTTGTTACTGGTTGCACTCATTTTTGGGACTGCTTCTTATCTG
ATTCGTGCCAGACGCAGTATGGATGAAGCTAACCAGCCTCTCCTCACTGATCAGTATCAA
TGCTATGCTGAAGAATATGAAAAACTCCAGAATCCTAATCAGTCTGTGGTCTAA
Protein Properties
Number of Residues 537
Molecular Weight 60723.8
Theoretical pI 5.86
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • 478-501
Protein Sequence
>5,6-dihydroxyindole-2-carboxylic acid oxidase
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
GenBank ID Protein 2735662
UniProtKB/Swiss-Prot ID P17643
UniProtKB/Swiss-Prot Entry Name TYRP1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF001295
GeneCard ID TYRP1
GenAtlas ID TYRP1
HGNC ID HGNC:12450
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  3. Basrur V, Yang F, Kushimoto T, Higashimoto Y, Yasumoto K, Valencia J, Muller J, Vieira WD, Watabe H, Shabanowitz J, Hearing VJ, Hunt DF, Appella E: Proteomic analysis of early melanosomes: identification of novel melanosomal proteins. J Proteome Res. 2003 Jan-Feb;2(1):69-79. [PubMed:12643545 ]
  4. Sturm RA, O'Sullivan BJ, Box NF, Smith AG, Smit SE, Puttick ER, Parsons PG, Dunn IS: Chromosomal structure of the human TYRP1 and TYRP2 loci and comparison of the tyrosinase-related protein gene family. Genomics. 1995 Sep 1;29(1):24-34. [PubMed:8530077 ]
  5. Cohen T, Muller RM, Tomita Y, Shibahara S: Nucleotide sequence of the cDNA encoding human tyrosinase-related protein. Nucleic Acids Res. 1990 May 11;18(9):2807-8. [PubMed:2111010 ]
  6. Chintamaneni CD, Ramsay M, Colman MA, Fox MF, Pickard RT, Kwon BS: Mapping the human CAS2 gene, the homologue of the mouse brown (b) locus, to human chromosome 9p22-pter. Biochem Biophys Res Commun. 1991 Jul 15;178(1):227-35. [PubMed:1906272 ]
  7. Box NF, Wyeth JR, Mayne CJ, O'Gorman LE, Martin NG, Sturm RA: Complete sequence and polymorphism study of the human TYRP1 gene encoding tyrosinase-related protein 1. Mamm Genome. 1998 Jan;9(1):50-3. [PubMed:9434945 ]
  8. Shibata K, Takeda K, Tomita Y, Tagami H, Shibahara S: Downstream region of the human tyrosinase-related protein gene enhances its promoter activity. Biochem Biophys Res Commun. 1992 Apr 30;184(2):568-75. [PubMed:1575733 ]
  9. Vijayasaradhi S, Bouchard B, Houghton AN: The melanoma antigen gp75 is the human homologue of the mouse b (brown) locus gene product. J Exp Med. 1990 Apr 1;171(4):1375-80. [PubMed:2324688 ]
  10. Urquhart A: Human tyrosinase-like protein (TYRL) carboxy terminus: closer homology with the mouse protein than previously reported. Nucleic Acids Res. 1991 Oct 25;19(20):5803. [PubMed:1945866 ]
  11. Halaban R, Moellmann G: Murine and human b locus pigmentation genes encode a glycoprotein (gp75) with catalase activity. Proc Natl Acad Sci U S A. 1990 Jun;87(12):4809-13. [PubMed:1693779 ]
  12. Rooryck C, Roudaut C, Robine E, Musebeck J, Arveiler B: Oculocutaneous albinism with TYRP1 gene mutations in a Caucasian patient. Pigment Cell Res. 2006 Jun;19(3):239-42. [PubMed:16704458 ]