Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02147
Secondary Accession Numbers
  • 7630
Name Integrin alpha-L
Synonyms
  1. CD11 antigen-like family member A
  2. CD11a antigen
  3. LFA-1A
  4. Leukocyte adhesion glycoprotein LFA-1 alpha chain
  5. Leukocyte function-associated molecule 1 alpha chain
Gene Name ITGAL
Protein Type Enzyme
Biological Properties
General Function Involved in cell adhesion
Specific Function Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes
Pathways Not Available
Reactions Not Available
GO Classification
Component
integrin complex
receptor complex
macromolecular complex
protein complex
Process
cell adhesion
cellular process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16p11.2
SNPs ITGAL
Gene Sequence
>3513 bp
ATGAAGGATTCCTGCATCACTGTGATGGCCATGGCGCTGCTGTCTGGGTTCTTTTTCTTC
GCGCCGGCCTCGAGCTACAACCTGGACGTGCGGGGCGCGCGGAGCTTCTCCCCACCGCGC
GCCGGGAGGCACTTTGGATACCGCGTCCTGCAGGTCGGAAACGGGGTCATCGTGGGAGCT
CCAGGGGAGGGGAACAGCACAGGAAGCCTCTATCAGTGCCAGTCGGGCACAGGACACTGC
CTGCCAGTCACCCTGAGAGGTTCCAACTATACCTCCAAGTACTTGGGAATGACCTTGGCA
ACAGACCCCACAGATGGAAGCATTTTGGCCTGTGACCCTGGGCTGTCTCGAACGTGTGAC
CAGAACACCTATCTGAGTGGCCTGTGTTACCTCTTCCGCCAGAATCTGCAGGGTCCCATG
CTGCAGGGGCGCCCTGGTTTTCAGGAATGTATCAAGGGCAACGTAGACCTGGTATTTCTG
TTTGATGGTTCGATGAGCTTGCAGCCAGATGAATTTCAGAAAATTCTGGACTTCATGAAG
GATGTGATGAAGAAACTCAGCAACACTTCGTACCAGTTTGCTGCTGTTCAGTTTTCCACA
AGCTACAAAACAGAATTTGATTTCTCAGATTATGTTAAATGGAAGGACCCTGATGCTCTG
CTGAAGCATGTAAAGCACATGTTGCTGTTGACCAATACCTTTGGTGCCATCAATTATGTC
GCGACAGAGGTGTTCCGGGAGGAGCTGGGGGCCCGGCCAGATGCCACCAAAGTGCTTATC
ATCATCACGGATGGGGAGGCCACTGACAGTGGCAACATCGATGCGGCCAAAGACATCATC
CGCTACATCATCGGGATTGGAAAGCATTTTCAGACCAAGGAGAGTCAGGAGACCCTCCAC
AAATTTGCATCAAAACCCGCGAGCGAGTTTGTGAAAATTCTGGACACATTTGAGAAGCTG
AAAGATCTATTCACTGAGCTGCAGAAGAAGATCTATGTCATTGAGGGCACAAGCAAACAG
GACCTGACTTCCTTCAACATGGAGCTGTCCTCCAGCGGCATCAGTGCTGACCTCAGCAGG
GGCCATGCAGTCGTGGGGGCAGTAGGAGCCAAGGACTGGGCTGGGGGCTTTCTTGACCTG
AAGGCAGACCTGCAGGATGACACATTTATTGGGAATGAACCATTGACACCAGAAGTGAGA
GCAGGCTATTTGGGTTACACCGTGACCTGGCTGCCCTCCCGGCAAAAGACTTCGTTGCTG
GCCTCGGGAGCCCCTCGATACCAGCACATGGGCCGAGTGCTGCTGTTCCAAGAGCCACAG
GGCGGAGGACACTGGAGCCAGGTCCAGACAATCCATGGGACCCAGATTGGCTCTTATTTC
GGTGGGGAGCTGTGTGGCGTCGACGTGGACCAAGATGGGGAGACAGAGCTGCTGCTGATT
GGTGCCCCACTGTTCTATGGGGAGCAGAGAGGAGGCCGGGTGTTTATCTACCAGAGAAGA
CAGTTGGGGTTTGAAGAAGTCTCAGAGCTGCAGGGGGACCCCGGCTACCCACTCGGGCGG
TTTGGAGAAGCCATCACTGCTCTGACAGACATCAACGGCGATGGGCTGGTAGACGTGGCT
GTGGGGGCCCCTCTGGAGGAGCAGGGGGCTGTGTACATCTTCAATGGGAGGCACGGGGGG
CTTAGTCCCCAGCCAAGTCAGCGGATAGAAGGGACCCAAGTGCTCTCAGGAATTCAGTGG
TTTGGACGCTCCATCCATGGGGTGAAGGACCTTGAAGGGGATGGCTTGGCAGATGTGGCT
GTGGGGGCTGAGAGCCAGATGATCGTGCTGAGCTCCCGGCCCGTGGTGGATATGGTCACC
CTGATGTCCTTCTCTCCAGCTGAGATCCCAGTGCATGAAGTGGAGTGCTCCTATTCAACC
AGTAACAAGATGAAAGAAGGAGTTAATATCACAATCTGTTTCCAGATCAAGTCTCTCTAC
CCCCAGTTCCAAGGCCGCCTGGTTGCCAATCTCACTTACACTCTGCAGCTGGATGGCCAC
CGGACCAGAAGACGGGGGTTGTTCCCAGGAGGGAGACATGAACTCAGAAGGAATATAGCT
GTCACCACCAGCATGTCATGCACTGACTTCTCATTTCATTTCCCGGTATGTGTTCAAGAC
CTCATCTCCCCCATCAATGTTTCCCTGAATTTCTCTCTTTGGGAGGAGGAAGGGACACCG
AGGGACCAAAGGGCGCAGGGCAAGGACATACCGCCCATCCTGAGACCCTCCCTGCACTCG
GAAACCTGGGAGATCCCTTTTGAGAAGAACTGTGGGGAGGACAAGAAGTGTGAGGCAAAC
TTGAGAGTGTCCTTCTCTCCTGCAAGATCCAGAGCCCTGCGTCTAACTGCTTTTGCCAGC
CTCTCTGTGGAGCTGAGCCTGAGTAACTTGGAAGAAGATGCTTACTGGGTCCAGCTGGAC
CTGCACTTCCCCCCGGGACTCTCCTTCCGCAAGGTGGAGATGCTGAAGCCCCATAGCCAG
ATACCTGTGAGCTGCGAGGAGCTTCCTGAAGAGTCCAGGCTTCTGTCCAGGGCATTATCT
TGCAATGTGAGCTCTCCCATCTTCAAAGCAGGCCACTCGGTTGCTCTGCAGATGATGTTT
AATACACTGGTAAACAGCTCCTGGGGGGACTCGGTTGAATTGCACGCCAATGTGACCTGT
AACAATGAGGACTCAGACCTCCTGGAGGACAACTCAGCCACTACCATCATCCCCATCCTG
TACCCCATCAACATCCTCATCCAGGACCAAGAAGACTCCACACTCTATGTCAGTTTCACC
CCCAAAGGCCCCAAGATCCACCAAGTCAAGCACATGTACCAGGTGAGGATCCAGCCTTCC
ATCCACGACCACAACATACCCACCCTGGAGGCTGTGGTTGGGGTGCCACAGCCTCCCAGC
GAGGGGCCCATCACACACCAGTGGAGCGTGCAGATGGAGCCTCCCGTGCCCTGCCACTAT
GAGGATCTGGAGAGGCTCCCGGATGCAGCTGAGCCTTGTCTCCCCGGAGCCCTGTTCCGC
TGCCCTGTTGTCTTCAGGCAGGAGATCCTCGTCCAAGTGATCGGGACTCTGGAGCTGGTG
GGAGAGATCGAGGCCTCTTCCATGTTCAGCCTCTGCAGCTCCCTCTCCATCTCCTTCAAC
AGCAGCAAGCATTTCCACCTCTATGGCAGCAACGCCTCCCTGGCCCAGGTTGTCATGAAG
GTTGACGTGGTGTATGAGAAGCAGATGCTCTACCTCTACGTGCTGAGCGGCATCGGGGGG
CTGCTGCTGCTGCTGCTCATTTTCATAGTGCTGTACAAGGTTGGTTTCTTCAAACGGAAC
CTGAAGGAGAAGATGGAGGCTGGCAGAGGTGTCCCGAATGGAATCCCTGCAGAAGACTCT
GAGCAGCTGGCATCTGGGCAAGAGGCTGGGGATCCCGGCTGCCTGAAGCCCCTCCATGAG
AAGGACTCTGAGAGTGGTGGTGGCAAGGACTGA
Protein Properties
Number of Residues 1170
Molecular Weight 128768.5
Theoretical pI 5.35
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • 1091-1111
Protein Sequence
>Integrin alpha-L
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
GenBank ID Protein 31422
UniProtKB/Swiss-Prot ID P20701
UniProtKB/Swiss-Prot Entry Name ITAL_HUMAN
PDB IDs
GenBank Gene ID Y00796
GeneCard ID ITGAL
GenAtlas ID ITGAL
HGNC ID HGNC:6148
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829 ]
  3. Shimaoka M, Xiao T, Liu JH, Yang Y, Dong Y, Jun CD, McCormack A, Zhang R, Joachimiak A, Takagi J, Wang JH, Springer TA: Structures of the alpha L I domain and its complex with ICAM-1 reveal a shape-shifting pathway for integrin regulation. Cell. 2003 Jan 10;112(1):99-111. [PubMed:12526797 ]
  4. Larson RS, Corbi AL, Berman L, Springer T: Primary structure of the leukocyte function-associated molecule-1 alpha subunit: an integrin with an embedded domain defining a protein superfamily. J Cell Biol. 1989 Feb;108(2):703-12. [PubMed:2537322 ]
  5. Shelley CS, Farokhzad OC, Arnaout MA: Identification of cell-specific and developmentally regulated nuclear factors that direct myeloid and lymphoid expression of the CD11a gene. Proc Natl Acad Sci U S A. 1993 Jun 1;90(11):5364-8. [PubMed:8099450 ]
  6. Nueda A, Lopez-Cabrera M, Vara A, Corbi AL: Characterization of the CD11a (alpha L, LFA-1 alpha) integrin gene promoter. J Biol Chem. 1993 Sep 15;268(26):19305-11. [PubMed:8103515 ]
  7. Cornwell RD, Gollahon KA, Hickstein DD: Description of the leukocyte function-associated antigen 1 (LFA-1 or CD11a) promoter. Proc Natl Acad Sci U S A. 1993 May 1;90(9):4221-5. [PubMed:8097887 ]
  8. Qu A, Leahy DJ: Crystal structure of the I-domain from the CD11a/CD18 (LFA-1, alpha L beta 2) integrin. Proc Natl Acad Sci U S A. 1995 Oct 24;92(22):10277-81. [PubMed:7479767 ]
  9. Qu A, Leahy DJ: The role of the divalent cation in the structure of the I domain from the CD11a/CD18 integrin. Structure. 1996 Aug 15;4(8):931-42. [PubMed:8805579 ]
  10. Kallen J, Welzenbach K, Ramage P, Geyl D, Kriwacki R, Legge G, Cottens S, Weitz-Schmidt G, Hommel U: Structural basis for LFA-1 inhibition upon lovastatin binding to the CD11a I-domain. J Mol Biol. 1999 Sep 10;292(1):1-9. [PubMed:10493852 ]