Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02184
Secondary Accession Numbers
  • 7669
Name Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
Synonyms
  1. Phosphorylase kinase alpha M subunit
Gene Name PHKA1
Protein Type Unknown
Biological Properties
General Function Involved in calmodulin binding
Specific Function Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
calmodulin binding
protein binding
glucan 1,4-alpha-glucosidase activity
glucosidase activity
Process
polysaccharide metabolic process
metabolic process
primary metabolic process
carbohydrate metabolic process
glycogen metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasmic side (Potential)
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs PHKA1
Gene Sequence
>3672 bp
ATGAGGAGCCGGAGTAACTCCGGGGTCCGGCTGGACGGCTACGCTCGACTGGTGCAACAG
ACCATCCTGTGCCATCAGAATCCAGTGACTGGCTTGCTTCCAGCCAGCTATGATCAGAAA
GATGCTTGGGTCCGAGATAATGTGTACAGCATCTTGGCTGTGTGGGGTTTGGGCCTGGCC
TATCGGAAGAATGCAGACCGGGATGAGGATAAGGCAAAGGCCTATGAATTGGAGCAGAGT
GTAGTGAAGCTGATGAGAGGACTACTGCACTGCATGATCAGACAGGTGGATAAAGTAGAA
TCCTTCAAATATAGTCAGAGTACTAAGGATAGCCTCCATGCAAAGTACAACACCAAAACC
TGTGCCACTGTAGTGGGTGATGATCAATGGGGACACCTGCAGTTGGATGCTACCTCTGTG
TACCTGCTCTTCTTAGCCCAAATGACTGCCTCAGGACTCCATATCATCCACAGCCTAGAT
GAAGTCAATTTCATACAGAACCTTGTGTTTTACATTGAAGCTGCATATAAAACTGCTGAC
TTCGGGATATGGGAACGTGGAGACAAGACCAACCAAGGGATCTCAGAGTTGAATGCCAGT
TCAGTTGGAATGGCAAAGGCAGCCCTGGAAGCATTAGATGAACTGGATCTGTTTGGTGTG
AAAGGTGGGCCTCAATCAGTTATCCATGTCCTGGCTGATGAAGTACAGCACTGCCAGTCT
ATCCTAAATTCACTACTGCCCCGTGCTTCAACATCAAAAGAGGTTGATGCTAGTCTACTC
TCAGTGGTTTCCTTCCCTGCCTTTGCAGTAGAGGATAGCCAGTTGGTGGAGCTCACAAAA
CAGGAAATCATCACCAAGCTTCAGGGTCGTTATGGTTGCTGTCGCTTTCTACGAGATGGA
TATAAAACTCCTAAAGAGGATCCCAATCGTCTGTACTATGAACCAGCTGAGCTGAAGCTA
TTTGAAAACATTGAGTGTGAATGGCCATTGTTCTGGACATACTTTATTCTTGATGGGGTC
TTCAGTGGCAATGCAGAACAGGTTCAAGAATATAAAGAGGCTCTTGAAGCAGTCCTCATC
AAGGGCAAAAATGGAGTCCCACTTCTGCCAGAGCTGTACAGTGTTCCTCCTGACAGGGTC
GATGAAGAATATCAGAATCCTCACACTGTGGACCGAGTCCCCATGGGGAAATTGCCTCAC
ATGTGGGGTCAGTCTCTATACATTTTAGGAAGCTTGATGGCAGAGGGATTTTTAGCCCCT
GGAGAAATTGATCCCCTGAATCGCAGGTTTTCTACTGTACCGAAGCCCGATGTTGTGGTT
CAAGTCTCCATTCTAGCTGAAACAGAAGAAATCAAGACCATTTTGAAGGACAAGGGAATT
TACGTGGAGACCATTGCTGAGGTATACCCCATCAGAGTACAACCAGCTCGTATTCTCAGC
CACATTTATTCCAGCCTAGGATGCAACAATAGAATGAAACTCAGTGGACGACCCTACAGA
CACATGGGAGTGCTTGGAACTTCAAAACTCTATGACATTCGGAAAACTATCTTTACTTTC
ACTCCACAGTTTATAGACCAGCAACAGTTCTACCTGGCTCTGGACAACAAGATGATAGTG
GAAATGCTTAGAACAGACCTCTCCTACCTCTGTAGCCGCTGGCGGATGACAGGCCAGCCC
ACCATCACCTTCCCCATCTCACACAGCATGCTTGATGAAGATGGAACAAGCTTGAATTCA
AGTATCCTGGCAGCACTCCGAAAAATGCAAGATGGGTATTTTGGTGGGGCAAGGGTTCAA
ACAGGTAAATTGTCAGAGTTTTTGACAACATCTTGTTGCACACACTTGAGCTTCATGGAC
CCTGGACCTGAGGGTAAGCTGTACAGTGAAGATTATGATGACAACTATGATTACCTGGAA
TCTGGCAACTGGATGAATGATTATGATTCAACCAGTCATGCTCGCTGTGGTGATGAAGTT
GCTCGTTATTTAGATCACCTTTTGGCGCACACTGCTCCCCATCCTAAACTAGCCCCTACC
TCACAGAAGGGAGGGCTAGATCGGTTCCAAGCTGCTGTGCAAACAACCTGCGACTTAATG
TCCTTGGTGACCAAGGCCAAGGAACTGCATGTACAGAATGTTCACATGTATCTTCCTACG
AAGTTATTTCAGGCTTCCCGGCCTTCATTCAACTTACTTGATTCACCTCATCCCCGACAG
GAGAACCAGGTTCCCTCTGTTCGTGTAGAAATACATCTTCCTAGAGACCAGTCTGGGGAG
GTGGACTTTAAAGCACTGGTTTTACAGTTGAAGGAGACCTCAAGCTTACAGGAACAAGCT
GATATCCTCTATATGCTGTATACTATGAAAGGACCTGACTGGAACACTGAATTGTATAAT
GAACGGAGTGCTACAGTGAGAGAGCTTCTTACCGAGCTGTATGGCAAAGTGGGAGAAATT
CGTCACTGGGGCCTGATCCGATACATTTCTGGGATCTTAAGGAAGAAAGTGGAAGCACTT
GATGAGGCCTGCACAGACCTTCTCTCCCACCAGAAACATTTGACAGTAGGACTTCCTCCA
GAACCTCGAGAAAAGACTATCTCTGCACCTCTGCCCTATGAGGCGCTCACTCAGCTGATA
GATGAAGCCAGTGAAGGGGATATGAGCATTTCAATCCTTACACAGGAAATAATGGTATAT
CTAGCCATGTATATGCGAACCCAGCCTGGCCTCTTTGCTGAAATGTTTCGACTTCGAATT
GGTCTGATCATACAAGTTATGGCAACAGAACTGGCCCACTCCCTTCGATGCTCAGCTGAG
GAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCGGCCATGAAGAATCTCCTGCATCAC
ATTCTCAGCGGCAAGGAGTTTGGAGTGGAACGAAGCGTTCGTCCCACTGATTCAAATGTC
AGTCCTGCTATTTCTATCCACGAGATTGGTGCTGTTGGAGCAACCAAAACAGAACGAACT
GGGATCATGCAGTTAAAAAGTGAGATAAAGCAGGTGGAATTTCGTAGACTGTCAATCTCA
GCTGAGAGTCAGTCACCTGGAACCTCTATGACTCCAAGTAGTGGGTCCTTTCCTAGTGCA
TATGATCAGCAGTCATCTAAAGATAGTCGTCAAGGTCAATGGCAACGCCGAAGAAGGCTG
GATGGGGCACTGAATAGAGTTCCAGTTGGATTTTATCAGAAAGTATGGAAAGTTTTGCAG
AAGTGTCACGGACTTTCTGTTGAAGGGTTTGTCCTTCCTTCCTCTACCACTAGAGAGATG
ACTCCAGGTGAGATTAAATTCTCTGTTCATGTGGAGTCTGTCCTGAATCGTGTACCTCAG
CCAGAGTACCGTCAGCTGCTGGTTGAAGCCATCCTTGTCCTCACCATGCTGGCAGATATT
GAAATTCATAGCATCGGAAGCATCATTGCTGTGGAAAAAATAGTGCATATTGCCAATGAC
TTGTTCCTTCAAGAACAGAAAACCCTTGGCGCAGATGATACCATGTTGGCAAAGGATCCC
GCATCTGGCATCTGTACTCTTCTGTATGACAGTGCACCCAGTGGCAGGTTTGGCACCATG
ACCTACCTCTCCAAGGCAGCCGCCACCTACGTGCAGGAGTTCCTGCCCCACAGCATCTGT
GCCATGCAATGA
Protein Properties
Number of Residues 1223
Molecular Weight 137310.8
Theoretical pI 6.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ
GenBank ID Protein 169881273
UniProtKB/Swiss-Prot ID P46020
UniProtKB/Swiss-Prot Entry Name KPB1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002637.3
GeneCard ID PHKA1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Wullrich A, Hamacher C, Schneider A, Kilimann MW: The multiphosphorylation domain of the phosphorylase kinase alpha M and alpha L subunits is a hotspot of differential mRNA processing and of molecular evolution. J Biol Chem. 1993 Nov 5;268(31):23208-14. [PubMed:8226841 ]
  5. Burwinkel B, Hu B, Schroers A, Clemens PR, Moses SW, Shin YS, Pongratz D, Vorgerd M, Kilimann MW: Muscle glycogenosis with low phosphorylase kinase activity: mutations in PHKA1, PHKG1 or six other candidate genes explain only a minority of cases. Eur J Hum Genet. 2003 Jul;11(7):516-26. [PubMed:12825073 ]