You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02202
Secondary Accession Numbers
  • 7687
Name Nucleobindin-2
Synonyms
  1. DNA-binding protein NEFA
  2. Gastric cancer antigen Zg4
Gene Name NUCB2
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Calcium-binding protein. May have a role in calcium homeostasis
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Secreted
  4. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.1
SNPs NUCB2
Gene Sequence
>1263 bp
ATGAGGTGGAGGACCATCCTGCTACAGTATTGCTTTCTCTTGATTACATGTTTACTTACT
GCTCTTGAAGCTGTGCCTATTGACATAGACAAGACAAAAGTACAAAATATTCACCCTGTG
GAAAGTGCGAAGATAGAACCACCAGATACTGGACTTTATTATGATGAATATCTCAAGCAA
GTGATTGATGTGCTGGAAACAGATAAACACTTCAGAGAAAAGCTCCAGAAAGCAGACATA
GAGGAAATAAAGAGTGGGAGGCTAAGCAAAGAACTGGATTTAGTAAGTCACCATGTGAGG
ACAAAACTTGATGAACTGAAAAGGCAAGAAGTAGGAAGGTTAAGAATGTTAATTAAAGCT
AAGTTGGATTCCCTTCAAGATATAGGCATGGACCACCAAGCTCTTCTAAAACAATTTGAT
CACCTAAACCACCTGAATCCTGACAAGTTTGAATCCACAGATTTAGATATGCTAATCAAA
GCGGCAACAAGTGATCTGGAACACTATGACAAGACTCGTCATGAAGAATTTAAAAAATAT
GAAATGATGAAGGAACATGAAAGGAGAGAATATTTAAAAACATTGAATGAAGAAAAGAGA
AAAGAAGAAGAGTCTAAATTTGAAGAAATGAAGAAAAAGCATGAAAATCACCCTAAAGTT
AATCACCCAGGAAGCAAAGATCAACTAAAAGAGGTATGGGAAGAGACTGATGGATTGGAT
CCTAATGACTTTGACCCCAAGACATTTTTCAAATTACATGATGTCAATAGTGATGGATTC
CTGGATGAACAAGAATTAGAAGCCCTATTTACTAAAGAGTTGGAGAAAGTATATGACCCT
AAAAATGAAGAGGATGATATGGTAGAAATGGAAGAAGAAAGGCTTAGAATGAGGGAACAT
GTAATGAATGAGGTTGATACTAACAAAGACAGATTGGTGACTCTGGAGGAGTTTTTGAAA
GCCACAGAAAAAAAAGAATTCTTGGAGCCAGATAGCTGGGAGACATTAGATCAGCAACAG
TTCTTCACAGAGGAAGAACTAAAAGAATATGAAAATATTATTGCTTTACAAGAAAATGAA
CTTAAGAAGAAGGCAGATGAGCTTCAGAAACAAAAAGAAGAGCTACAACGTCAGCATGAT
CAACTGGAGGCTCAGAAGCTGGAATATCATCAGGTCATACAGCAGATGGAACAAAAAAAA
TTACAACAAGGAATTCCTCCATCAGGGCCAGCTGGAGAATTGAAGTTTGAGCCACACATT
TAA
Protein Properties
Number of Residues 420
Molecular Weight 50195.4
Theoretical pI 4.78
Pfam Domain Function Not Available
Signals
  • 1-24
Transmembrane Regions
  • None
Protein Sequence
>Nucleobindin-2
MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQ
VIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKA
KLDSLQDIGMDHQALLKQFDHLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKY
EMMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKEVWEETDGLD
PNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDPKNEEDDMVEMEEERLRMREH
VMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENE
LKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
GenBank ID Protein 4826870
UniProtKB/Swiss-Prot ID P80303
UniProtKB/Swiss-Prot Entry Name NUCB2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005013.2
GeneCard ID NUCB2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Barnikol-Watanabe S, Gross NA, Gotz H, Henkel T, Karabinos A, Kratzin H, Barnikol HU, Hilschmann N: Human protein NEFA, a novel DNA binding/EF-hand/leucine zipper protein. Molecular cloning and sequence analysis of the cDNA, isolation and characterization of the protein. Biol Chem Hoppe Seyler. 1994 Aug;375(8):497-512. [PubMed:7811391 ]
  5. DeAngelis MM, Doucet JP, Drury S, Sherry ST, Robichaux MB, Den Z, Pelias MZ, Ditta GM, Keats BJ, Deininger PL, Batzer MA: Assembly of a high-resolution map of the Acadian Usher syndrome region and localization of the nuclear EF-hand acidic gene. Biochim Biophys Acta. 1998 Jul 1;1407(1):84-91. [PubMed:9639681 ]
  6. Line A, Stengrevics A, Slucka Z, Li G, Jankevics E, Rees RC: Serological identification and expression analysis of gastric cancer-associated genes. Br J Cancer. 2002 Jun 5;86(11):1824-30. [PubMed:12087473 ]