You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02207
Secondary Accession Numbers
  • 7692
Name DNA topoisomerase 2-beta
Synonyms
  1. DNA topoisomerase II, beta isozyme
Gene Name TOP2B
Protein Type Enzyme
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks. Indirectly ivolved in vitamin D- coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR- mediated transrepression of the CYP27B1 gene
Pathways
  • Etoposide Action Pathway
  • Etoposide Metabolism Pathway
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
chromosome
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
dna topoisomerase (atp-hydrolyzing) activity
dna topoisomerase activity
nucleic acid binding
dna binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna topological change
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
Gene Properties
Chromosome Location Chromosome:3
Locus 3p24
SNPs TOP2B
Gene Sequence
>4866 bp
ATGGCCAAGTCGGGTGGCTGCGGCGCGGGAGCCGGCGTGGGCGGCGGCAACGGGGCACTG
ACCTGGGTGAACAATGCTGCAAAAAAAGAAGAGTCAGAAACTGCCAACAAAAATGATTCT
TCAAAGAAGTTGTCTGTTGAGAGAGTGTATCAGAAGAAGACACAACTTGAACACATTCTT
CTTCGTCCTGATACATATATTGGGTCAGTGGAGCCATTGACGCAGTTCATGTGGGTGTAT
GATGAAGATGTAGGAATGAATTGCAGGGAGGTTACCTTTGTGCCAGGTTTATACAAGATC
TTTGATGAAATTTTGGTTAATGCTGCTGACAATAAACAGAGGGATAAGAACATGACTTGT
ATTAAAGTTTCTATTGATCCTGAATCTAACATTATAAGCATTTGGAATAATGGGAAAGGC
ATTCCAGTAGTAGAACACAAGGTAGAGAAAGTTTATGTTCCTGCTTTAATTTTTGGACAG
CTTTTAACATCCAGTAACTATGATGATGATGAGAAAAAAGTTACAGGTGGTCGTAATGGT
TATGGTGCAAAACTTTGTAATATTTTCAGTACAAAGTTTACAGTAGAAACAGCTTGCAAA
GAATACAAACACAGTTTTAAGCAGACATGGATGAATAATATGATGAAGACTTCTGAAGCC
AAAATTAAACATTTTGATGGTGAAGATTACACATGCATAACATTCCAACCAGATCTGTCC
AAATTTAAGATGGAAAAACTTGACAAGGATATTGTGGCCCTCATGACTAGAAGGGCATAT
GATTTGGCTGGTTCGTGTAGAGGGGTCAAGGTCATGTTTAATGGAAAGAAATTGCCTGTA
AATGGATTTCGCAGTTATGTAGATCTTTATGTGAAAGACAAATTGGATGAAACTGGGGTG
GCCCTGAAAGTTATTCATGAGCTTGCAAATGAAAGATGGGATGTTTGTCTCACATTGAGT
GAAAAAGGATTCCAGCAAATCAGCTTTGTAAATAGTATTGCAACTACAAAAGGTGGACGG
CACGTGGATTATGTGGTAGATCAAGTTGTTGGTAAACTGATTGAAGTAGTTAAGAAAAAG
AACAAAGCTGGTGTATCAGTGAAACCATTTCAAGTAAAAAACCATATATGGGTTTTTATT
AATTGCCTTATTGAAAATCCAACTTTTGATTCTCAGACTAAGGAAAACATGACTCTGCAG
CCCAAAAGTTTTGGGTCTAAATGCCAGCTGTCAGAAAAATTTTTTAAAGCAGCCTCTAAT
TGTGGCATTGTAGAAAGTATCCTGAACTGGGTGAAATTTAAGGCTCAGACTCAGCTGAAT
AAGAAGTGTTCATCAGTAAAATACAGTAAAATCAAAGGTATTCCCAAACTGGATGATGCT
AATGATGCTGGTGGTAAACATTCCCTGGAGTGTACACTGATATTAACAGAGGGAGACTCT
GCCAAATCACTGGCTGTGTCTGGATTAGGTGTGATTGGACGAGACAGATACGGAGTTTTT
CCACTCAGGGGCAAAATTCTTAATGTACGGGAAGCTTCTCATAAACAGATCATGGAAAAT
GCTGAAATAAATAATATTATTAAAATAGTTGGTCTACAATATAAGAAAAGTTACGATGAT
GCAGAATCTCTGAAAACCTTACGCTATGGAAAGATTATGATTATGACCGATCAGGATCAA
GATGGTTCTCACATAAAAGGCCTGCTTATTAATTTCATCCATCACAATTGGCCATCACTT
TTGAAGCATGGTTTTCTTGAAGAGTTCATTACTCCTATTGTAAAGGCAAGCAAAAATAAG
CAGGAACTTTCCTTCTACAGTATTCCTGAATTTGACGAATGGAAAAAACATATAGAAAAC
CAGAAAGCCTGGAAAATAAAGTACTATAAAGGATTGGGTACTAGTACAGCTAAAGAAGCA
AAGGAATATTTTGCTGATATGGAAAGGCATCGCATCTTGTTTAGATATGCTGGTCCTGAA
GATGATGCTGCCATTACCTTGGCATTTAGTAAGAAGAAGATTGATGACAGAAAAGAATGG
TTAACAAATTTTATGGAAGACCGGAGACAGCGTAGGCTACATGGCTTACCAGAGCAATTT
TTATATGGTACTGCAACAAAGCATTTGACTTATAATGATTTCATCAACAAGGAATTGATT
CTCTTCTCAAACTCAGACAATGAAAGATCTATACCATCTCTTGTTGATGGCTTTAAACCT
GGCCAGCGGAAAGTTTTATTTACCTGTTTCAAGAGGAATGATAAACGTGAAGTAAAAGTT
GCCCAGTTGGCTGGCTCTGTTGCTGAGATGTCGGCTTATCATCATGGAGAACAAGCATTG
ATGATGACTATTGTGAATTTGGCTCAGAACTTTGTGGGAAGTAACAACATTAACTTGCTT
CAGCCTATTGGTCAGTTTGGAACTCGGCTTCATGGTGGCAAAGATGCTGCAAGCCCTCGT
TATATTTTCACAATGTTAAGCACTTTAGCAAGGCTACTTTTTCCTGCTGTGGATGACAAC
CTCCTTAAGTTCCTTTATGATGATAATCAACGTGTAGAGCCTGAGTGGTATATTCCTATA
ATTCCCATGGTTTTAATAAATGGTGCTGAGGGCATTGGTACTGGATGGGCTTGTAAACTA
CCCAACTATGATGCTAGGGAAATTGTGAACAATGTCAGACGAATGCTAGATGGCCTGGAT
CCTCATCCCATGCTTCCAAACTACAAAAACTTTAAAGGCACGATTCAAGAACTTGGTCAA
AACCAGTATGCAGTCAGTGGTGAAATATTTGTAGTGGACAGAAACACAGTAGAAATTACA
GAGCTTCCAGTTAGAACTTGGACACAGGTATATAAAGAACAGGTTTTAGAACCTATGCTA
AATGGAACAGATAAAACACCAGCATTAATTTCTGATTATAAAGAATATCATACTGACACA
ACTGTGAAATTTGTGGTGAAAATGACTGAAGAGAAACTAGCACAAGCAGAAGCTGCTGGA
CTGCATAAAGTTTTTAAACTTCAAACTACTCTTACTTGTAATTCCATGGTACTTTTTGAT
CATATGGGATGTCTGAAGAAATATGAAACTGTGCAAGACATTCTGAAAGAATTCTTTGAT
TTACGATTAAGTTATTACGGTTTACGTAAGGAGTGGCTTGTGGGAATGTTGGGAGCAGAA
TCTACAAAGCTTAACAATCAAGCCCGTTTCATTTTAGAGAAGATACAAGGGAAAATTACT
ATAGAGAATAGGTCAAAGAAAGATTTGATTCAAATGTTAGTCCAGAGAGGTTATGAATCT
GACCCAGTGAAAGCCTGGAAAGAAGCACAAGAAAAGGCAGCAGAAGAGGATGAAACACAA
AACCAGCATGATGATAGTTCCTCCGATTCAGGAACTCCTTCAGGCCCAGATTTTAATTAT
ATTTTAAATATGTCTCTGTGGTCTCTTACTAAAGAAAAAGTTGAAGAACTGATTAAACAG
AGAGATGCAAAAGGGCGAGAGGTCAATGATCTTAAAAGAAAATCTCCTTCAGATCTTTGG
AAAGAGGATTTAGCGGCATTTGTTGAAGAACTGGATAAAGTGGAATCTCAAGAACGAGAA
GATGTTCTGGCTGGAATGTCTGGAAAAGCAATTAAAGGTAAAGTTGGCAAACCTAAGGTG
AAGAAACTCCAGTTGGAAGAGACAATGCCCTCACCTTATGGCAGAAGAATAATTCCTGAA
ATTACAGCTATGAAGGCAGATGCCAGCAAAAAGTTGCTGAAGAAGAAGAAGGGTGATCTT
GATACTGCAGCAGTAAAAGTGGAATTTGATGAAGAATTCAGTGGAGCACCAGTAGAAGGT
GCAGGAGAAGAGGCATTGACTCCATCAGTTCCTATAAATAAAGGTCCCAAACCTAAGAGG
GAGAAGAAGGAGCCTGGTACCAGAGTGAGAAAAACACCTACATCATCTGGTAAACCTAGT
GCAAAGAAAGTGAAGAAACGGAATCCTTGGTCAGATGATGAATCCAAGTCAGAAAGTGAT
TTGGAAGAAACAGAACCTGTGGTTATTCCAAGAGATTCTTTGCTTAGGAGAGCAGCAGCC
GAAAGACCTAAATACACATTTGATTTCTCAGAAGAAGAGGATGATGATGCTGATGATGAT
GATGATGACAATAATGATTTAGAGGAATTGAAAGTTAAAGCATCTCCCATAACAAATGAT
GGGGAAGATGAATTTGTTCCTTCAGATGGGTTAGATAAAGATGAATATACATTTTCACCA
GGCAAATCAAAAGCCACTCCAGAAAAATCTTTGCATGACAAAAAAAGTCAGGATTTTGGA
AATCTCTTCTCATTTCCTTCATATTCTCAGAAGTCAGAAGATGATTCAGCTAAATTTGAC
AGTAATGAAGAAGATTCTGCTTCTGTTTTTTCACCATCATTTGGTCTGAAACAGACAGAT
AAAGTTCCAAGTAAAACGGTAGCTGCTAAAAAGGGAAAACCGTCTTCAGATACAGTCCCT
AAGCCCAAGAGAGCCCCAAAACAGAAGAAAGTAGTAGAGGCTGTAAACTCTGACTCGGAT
TCAGAATTTGGCATTCCAAAGAAGACTACAACACCAAAAGGTAAAGGCCGAGGGGCAAAG
AAAAGGAAAGCATCTGGCTCTGAAAATGAAGGCGATTATAACCCTGGCAGGAAAACATCC
AAAACAACAAGCAAGAAACCGAAGAAGACATCTTTTGATCAGGATTCAGATGTGGACATC
TTCCCCTCAGACTTCCCTACTGAGCCACCTTCTCTGCCACGAACCGGTCGGGCTAGGAAA
GAAGTAAAATATTTTGCAGAGTCTGATGAAGAAGAAGATGATGTTGATTTTGCAATGTTT
AATTAA
Protein Properties
Number of Residues 1626
Molecular Weight 183265.8
Theoretical pI 8.16
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>DNA topoisomerase 2-beta
MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQ
LEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRD
KNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVT
GGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITF
QPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKL
DETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIE
VVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLIL
TEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYK
KSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVK
ASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFR
YAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFI
NKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHH
GEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRM
LDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQV
LEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNS
MVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKI
QGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSG
PDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVE
SQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTS
SGKPSAKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDD
DADDDDDDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKK
SQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPS
SDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNP
GRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDV
DFAMFN
GenBank ID Protein 19913408
UniProtKB/Swiss-Prot ID Q02880
UniProtKB/Swiss-Prot Entry Name TOP2B_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID TOP2B
GenAtlas ID TOP2B
HGNC ID HGNC:11990
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  9. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921 ]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  11. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  12. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  13. Jenkins JR, Ayton P, Jones T, Davies SL, Simmons DL, Harris AL, Sheer D, Hickson ID: Isolation of cDNA clones encoding the beta isozyme of human DNA topoisomerase II and localisation of the gene to chromosome 3p24. Nucleic Acids Res. 1992 Nov 11;20(21):5587-92. [PubMed:1333583 ]
  14. Austin CA, Sng JH, Patel S, Fisher LM: Novel HeLa topoisomerase II is the II beta isoform: complete coding sequence and homology with other type II topoisomerases. Biochim Biophys Acta. 1993 Mar 20;1172(3):283-91. [PubMed:8383537 ]
  15. Chung TD, Drake FH, Tan KB, Per SR, Crooke ST, Mirabelli CK: Characterization and immunological identification of cDNA clones encoding two human DNA topoisomerase II isozymes. Proc Natl Acad Sci U S A. 1989 Dec;86(23):9431-5. [PubMed:2556712 ]
  16. Sng JH, Heaton VJ, Bell M, Maini P, Austin CA, Fisher LM: Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication. Biochim Biophys Acta. 1999 Mar 19;1444(3):395-406. [PubMed:10095062 ]
  17. Austin CA, Fisher LM: Isolation and characterization of a human cDNA clone encoding a novel DNA topoisomerase II homologue from HeLa cells. FEBS Lett. 1990 Jun 18;266(1-2):115-7. [PubMed:2163884 ]
  18. Yuwen H, Hsia CC, Nakashima Y, Evangelista A, Tabor E: Binding of wild-type p53 by topoisomerase II and overexpression of topoisomerase II in human hepatocellular carcinoma. Biochem Biophys Res Commun. 1997 May 8;234(1):194-7. [PubMed:9168988 ]
  19. Davies SL, Jenkins JR, Hickson ID: Human cells express two differentially spliced forms of topoisomerase II beta mRNA. Nucleic Acids Res. 1993 Aug 11;21(16):3719-23. [PubMed:8396237 ]
  20. Mirski SE, Bielawski JC, Cole SP: Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta. Biochem Biophys Res Commun. 2003 Jul 11;306(4):905-11. [PubMed:12821127 ]
  21. Kitagawa H, Fujiki R, Yoshimura K, Mezaki Y, Uematsu Y, Matsui D, Ogawa S, Unno K, Okubo M, Tokita A, Nakagawa T, Ito T, Ishimi Y, Nagasawa H, Matsumoto T, Yanagisawa J, Kato S: The chromatin-remodeling complex WINAC targets a nuclear receptor to promoters and is impaired in Williams syndrome. Cell. 2003 Jun 27;113(7):905-17. [PubMed:12837248 ]