You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02211
Secondary Accession Numbers
  • 7696
Name CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
Synonyms
  1. Alpha 2,3-ST 1
  2. Beta-galactoside alpha-2,3-sialyltransferase 1
  3. Gal-NAc6S
  4. Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  5. SIAT4-A
  6. SIATFL
  7. ST3Gal I
  8. ST3GalA.1
  9. ST3GalI
  10. ST3O
  11. Sialyltransferase 4A
Gene Name ST3GAL1
Protein Type Enzyme
Biological Properties
General Function Involved in beta-galactoside alpha-2,3-sialyltransferas
Specific Function It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found on sugar chains O-linked to Thr or Ser and also as a terminal sequence on certain gangliosides. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
Pathways
  • Glycosaminoglycan biosynthesis - keratan sulfate
  • Glycosphingolipid biosynthesis - ganglio series
  • Glycosphingolipid biosynthesis - globo series
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + beta-D-galactosyl-1,3-N-acetyl-alpha-D-galactosaminyl-R → Cytidine monophosphate + alpha-N-acetylneuraminyl-2,3-beta-D-galactosyl-1,3-N-acetyl-alpha-D-galactosaminyl-R details
CMP-N-acetylneuraminate + T antigen → CMP + details
CMP-N-acetylneuraminate + GM1 → CMP + GD1a details
CMP-N-acetylneuraminate + GD1b → CMP + GT1b details
CMP-N-acetylneuraminate + GA1 → CMP + GM1b details
CMP-N-acetylneuraminate + Galactosylgloboside → CMP + Monosialylgalactosylgloboside details
GO Classification
Biological Process
keratan sulfate biosynthetic process
O-glycan processing
post-translational protein modification
protein phosphorylation
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
extracellular region
Golgi membrane
Component
cell part
membrane part
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to golgi membrane
integral to golgi membrane
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
sialyltransferase activity
Molecular Function
beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Secreted
  2. Single-pass type II membrane protein
  3. Golgi apparatus
  4. Golgi stack membrane
Gene Properties
Chromosome Location 8
Locus 8q24.22
SNPs ST3GAL1
Gene Sequence
>1023 bp
ATGGTGACCCTGCGGAAGAGGACCCTGAAAGTGCTCACCTTCCTCGTGCTCTTCATCTTC
CTCACCTCCTTCTTCCTGAACTACTCCCACACCATGGTGGCCACCACCTGGTTCCCCAAG
CAGATGGTCCTGGAGCTCTCCGAGAACCTGAAGAGACTGATCAAGCACAGGCCTTGCACC
TGCACCCACTGCATCGGGCAGCGCAAGCTCTCGGCCTGGTTCGATGAGAGGTTCAACCAG
ACCATGCAGCCGCTCGTGACCGCCCAGAACGCGCTCTTGGAGGACGACACCTACCGATGG
TGGCTGAGGCTCCAGCGGGAGAAGAAGCCCAATAACTTGAATGACACCATCAAGGAGCTG
TTCAGAGTGGTGCCTGGGAATGTGGACCCTATGCTGGAGAAGAGGTCGGTGGGCTGCCGG
CGCTGCGCTGTGGTGGGCAACTCGGGCAACCTGAGGGAGTCTTCTTATGGGCCTGAGATA
GACAGTCACGACTTTGTCCTCAGGATGAACAAGGCGCCCACGGCAGGGTTTGAAGCTGAT
GTTGGGACCAAGACCACCCACCATCTGGTGTACCCTGAGAGCTTCCGGGAGCTGGGAGAT
AATGTCAGCATGATCCTGGTGCCCTTCAAGACCATCGACTTGGAGTGGGTGGTGAGGGCC
ATCACCACGGGCACCATTTCCCACACCTACATCCCGGTTCCTGCAAAGATCAGAGTGAAA
CAGGATAAGATCCTGATCTACCACCCAGCCTTCATCAAGTATGTCTTTGACAACTGGCTG
CAAGGGCACGGGCGATACCCATCTACCGGCATCCTCTCAGTCATCTTCTCAATGCATGTC
TGCGATGAGGTGGACTTGTACGGCTTCGGGGCAGACAGCAAAGGGAACTGGCACCACTAC
TGGGAGAACAACCCATCCGCGGGGGCTTTTCGCAAGACGGGGGTGCACGATGCAGACTTT
GAGTCTAACGTGACGGCCACCTTGGCCTCCATCAATAAAATCCGGATCTTCAAGGGGAGA
TGA
Protein Properties
Number of Residues 340
Molecular Weight 39074.745
Theoretical pI 9.081
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCT
CTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKEL
FRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
VGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVK
QDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR
GenBank ID Protein 3169564
UniProtKB/Swiss-Prot ID Q11201
UniProtKB/Swiss-Prot Entry Name SIA4A_HUMAN
PDB IDs Not Available
GenBank Gene ID AF059321
GeneCard ID ST3GAL1
GenAtlas ID Not Available
HGNC ID HGNC:10862
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kitagawa H, Paulson JC: Differential expression of five sialyltransferase genes in human tissues. J Biol Chem. 1994 Jul 8;269(27):17872-8. [PubMed:8027041 ]
  3. Chang ML, Eddy RL, Shows TB, Lau JT: Three genes that encode human beta-galactoside alpha 2,3-sialyltransferases. Structural analysis and chromosomal mapping studies. Glycobiology. 1995 May;5(3):319-25. [PubMed:7655169 ]
  4. Shang J, Qiu R, Wang J, Liu J, Zhou R, Ding H, Yang S, Zhang S, Jin C: Molecular cloning and expression of Galbeta1,3GalNAc alpha2, 3-sialyltransferase from human fetal liver. Eur J Biochem. 1999 Oct;265(2):580-8. [PubMed:10504389 ]