Hmdb loader
Identification
HMDB Protein ID HMDBP02226
Secondary Accession Numbers
  • 7711
Name Cocaine- and amphetamine-regulated transcript protein
Synonyms
  1. CART(1-39)
  2. CART(42-89)
Gene Name CARTPT
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular space
Function
binding
protein binding
Process
phosphorus metabolic process
phosphate metabolic process
response to stimulus
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of response to stimulus
regulation of response to external stimulus
regulation of response to extracellular stimulus
regulation of response to nutrient levels
regulation of response to food
negative regulation of response to food
negative regulation of appetite
response to external stimulus
response to extracellular stimulus
response to nutrient levels
cellular response to nutrient levels
cellular response to starvation
behavior
feeding behavior
adult feeding behavior
carbohydrate homeostasis
glucose homeostasis
cellular glucose homeostasis
activation of mapkk activity
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
phosphorylation
regulation of biological quality
homeostatic process
chemical homeostasis
Cellular Location
  1. Secreted (Potential)
Gene Properties
Chromosome Location Chromosome:5
Locus 5q13.2
SNPs CARTPT
Gene Sequence
>351 bp
ATGGAGAGCTCCCGCGTGAGGCTGCTGCCCCTCCTGGGCGCCGCCCTGCTGCTGATGCTA
CCTCTGTTGGGTACCCGTGCCCAGGAGGACGCCGAGCTCCAGCCCCGAGCCCTGGACATC
TACTCTGCCGTGGATGATGCCTCCCACGAGAAGGAGCTGATCGAAGCGCTGCAAGAAGTC
TTGAAGAAGCTCAAGAGTAAACGTGTTCCCATCTATGAGAAGAAGTATGGCCAAGTCCCC
ATGTGTGACGCCGGTGAGCAGTGTGCAGTGAGGAAAGGGGCAAGGATCGGGAAGCTGTGT
GACTGTCCCCGAGGAACCTCCTGCAATTCCTTCCTCCTGAAGTGCTTATGA
Protein Properties
Number of Residues 116
Molecular Weight 12829.0
Theoretical pI 8.37
Pfam Domain Function
Signals
  • 1-27
Transmembrane Regions
  • None
Protein Sequence
>Cocaine- and amphetamine-regulated transcript protein
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16568
UniProtKB/Swiss-Prot Entry Name CART_HUMAN
PDB IDs
GenBank Gene ID U16826
GeneCard ID CARTPT
GenAtlas ID CARTPT
HGNC ID HGNC:24323
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161 ]
  3. Douglass J, Daoud S: Characterization of the human cDNA and genomic DNA encoding CART: a cocaine- and amphetamine-regulated transcript. Gene. 1996 Mar 9;169(2):241-5. [PubMed:8647455 ]
  4. Kristensen P, Judge ME, Thim L, Ribel U, Christjansen KN, Wulff BS, Clausen JT, Jensen PB, Madsen OD, Vrang N, Larsen PJ, Hastrup S: Hypothalamic CART is a new anorectic peptide regulated by leptin. Nature. 1998 May 7;393(6680):72-6. [PubMed:9590691 ]
  5. Ludvigsen S, Thim L, Blom AM, Wulff BS: Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry. 2001 Aug 7;40(31):9082-8. [PubMed:11478874 ]
  6. Challis BG, Yeo GS, Farooqi IS, Luan J, Aminian S, Halsall DJ, Keogh JM, Wareham NJ, O'Rahilly S: The CART gene and human obesity: mutational analysis and population genetics. Diabetes. 2000 May;49(5):872-5. [PubMed:10905499 ]
  7. del Giudice EM, Santoro N, Cirillo G, D'Urso L, Di Toro R, Perrone L: Mutational screening of the CART gene in obese children: identifying a mutation (Leu34Phe) associated with reduced resting energy expenditure and cosegregating with obesity phenotype in a large family. Diabetes. 2001 Sep;50(9):2157-60. [PubMed:11522684 ]