You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02245
Secondary Accession Numbers
  • 7730
Name Potassium voltage-gated channel subfamily H member 6
Synonyms
  1. ERG-2
  2. Eag-related protein 2
  3. Ether-a-go-go-related gene potassium channel 2
  4. Ether-a-go-go-related protein 2
  5. Voltage-gated potassium channel subunit Kv11.2
  6. hERG-2
  7. hERG2
Gene Name KCNH6
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current. Channel properties may be modulated by cAMP and subunit assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
regulation of cellular process
signal transduction
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q23.3
SNPs KCNH6
Gene Sequence
>2985 bp
ATGCCGGTCCGCAGGGGCCACGTCGCTCCCCAAAACACTTACCTGGACACCATCATCCGC
AAGTTCGAGGGCCAAAGTCGGAAGTTCCTGATTGCCAATGCTCAGATGGAGAACTGCGCC
ATCATTTACTGCAACGACGGCTTCTGCGAACTCTTCGGCTACTCCCGAGTGGAGGTGATG
CAGCAACCCTGCACCTGCGACTTCCTCACAGGCCCCAACACACCAAGCAGCGCCGTGTCC
CGCCTAGCGCAGGCCCTGCTGGGGGCTGAGGAGTGCAAGGTGGACATCCTCTACTACCGC
AAGGATGCCTCCAGCTTCCGCTGCCTGGTAGATGTGGTGCCCGTGAAGAACGAGGACGGG
GCTGTCATCATGTTCATTCTCAACTTCGAGGACCTGGCCCAGCTCCTGGCCAAGTGCAGC
AGCCGCAGCTTGTCCCAGCGCCTGTTGTCCCAGAGCTTCCTGGGCTCCGAGGGCTCTCAC
GGCAGGCCAGGCGGACCAGGGCCAGGCACAGGCAGGGGCAAGTACAGGACCATCAGCCAG
ATCCCACAGTTCACGCTCAACTTCGTGGAGTTCAACTTGGAGAAGCACCGCTCCAGCTCC
ACCACGGAGATTGAGATCATCGCGCCCCATAAGGTGGTGGAGCGGACACAGAACGTCACT
GAGAAGGTCACCCAGGTCCTGTCCCTGGGCGCGGATGTGCTGCCGGAGTACAAGCTGCAG
GCGCCGCGCATCCACCGCTGGACCATCCTGCACTACAGCCCCTTCAAGGCCGTGTGGGAC
TGGCTCATCCTGCTGCTGGTCATCTACACGGCTGTCTTCACGCCCTACTCAGCCGCCTTC
CTGCTCAGCGACCAGGACGAATCACGGCGTGGGGCCTGCAGCTATACCTGCAGTCCCCTC
ACTGTGGTGGATCTCATCGTGGACATCATGTTCGTCGTGGACATCGTCATCAACTTCCGC
ACCACCTATGTCAACACCAATGATGAGGTGGTCAGCCACCCCCGCCGCATCGCCGTCCAC
TACTTCAAGGGCTGGTTCCTCATTGACATGGTGGCCGCCATCCCTTTCGACCTCCTGATC
TTCCGCACTGGCTCCGATGAGACCACAACCCTGATTGGGCTATTGAAGACAGCGCGGCTG
CTGCGGCTGGTGCGCGTAGCACGGAAGCTGGACCGCTACTCTGAGTATGGGGCGGCTGTG
CTCTTCTTGCTCATGTGCACCTTCGCGCTCATAGCGCACTGGCTGGCCTGCATCTGGTAC
GCCATCGGCAATGTGGAGCGGCCCTACCTAGAACACAAGATCGGCTGGCTGGACAGCCTG
GGTGTGCAGCTTGGCAAGCGCTACAACGGCAGCGACCCAGCCTCGGGCCCCTCGGTGCAG
GACAAGTATGTCACAGCCCTCTACTTCACCTTCAGCAGCCTCACCAGCGTGGGCTTCGGC
AATGTCTCGCCCAACACCAACTCCGAGAAGGTCTTCTCCATCTGCGTCATGCTCATCGGC
TCCCTGATGTACGCCAGCATCTTCGGGAACGTGTCCGCGATCATCCAGCGCCTGTACTCG
GGCACCGCGCGCTACCACACGCAGATGCTGCGTGTCAAGGAGTTCATCCGCTTCCACCAG
ATCCCCAACCCACTGCGCCAGCGCCTGGAGGAGTATTTCCAGCACGCCTGGTCCTACACC
AATGGCATTGACATGAACGCGGTGCTGAAGGGCTTCCCCGAGTGCCTGCAGGCTGACATC
TGCCTGCACCTGCACCGCGCACTGCTGCAGCACTGCCCAGCTTTCAGCGGCGCCGGCAAG
GGCTGCCTGCGCGCGCTAGCCGTCAAGTTCAAGACCACCCACGCGCCGCCTGGGGACACG
CTGGTGCACCTCGGCGACGTGCTCTCCACCCTCTACTTCATCTCCCGAGGCTCCATCGAG
ATCCTGCGCGACGACGTGGTCGTGGCCATCCTAGGAAAGAATGACATCTTTGGGGAACCC
GTCAGCCTCCATGCCCAGCCAGGCAAGTCCAGTGCAGACGTGCGGGCTCTGACCTACTGC
GACCTGCACAAGATCCAGCGGGCAGATCTGCTGGAGGTGCTGGACATGTACCCGGCCTTT
GCGGAGAGCTTCTGGAGTAAGCTGGAGGTCACCTTCAACCTGCGGGACGCAGCCGGGGGT
CTCCACTCATCCCCCCGACAGGCTCCTGGCAGCCAAGACCACCAAGGTTTCTTTCTCAGT
GACAACCAGTCAGGGTCTCCCCATGAGCTGGGGCCCCAGTTCCCCTCTAAGGGCTACAGC
CTCCTGGGTCCTGGGAGCCAGAACTCCATGGGGGCAGGACCTTGTGCTCCAGGGCACCCA
GATGCAGCCCCTCCCCTGAGCATCTCAGATGCATCTGGCCTCTGGCCTGAGCTACTGCAG
GAAATGCCCCCAAGGCACAGCCCCCAAAGCCCTCAGGAAGACCCAGATTGCTGGCCTCTG
AAGCTGGGCTCCAGGCTAGAGCAGCTCCAGGCCCAGATGAACAGGCTGGAGTCCCGCGTG
TCCTCAGACCTCAGCCGCATCTTGCAGCTCCTCCAGAAGCCCATGCCCCAGGGCCACGCC
AGCTACATTCTGGAAGCCCCTGCCTCCAATGACCTGGCCTTGGTTCCTATAGCCTCGGAG
ACGACGAGTCCAGGGCCCAGGCTGCCCCAGGGCTTTCTGCCTCCTGCACAGACCCCAAGC
TATGGAGACTTGGATGACTGTAGTCCAAAGCACAGGAACTCCTCCCCCAGGATGCCTCAC
CTGGCTGTGGCAACGGACAAAACTCTGGCACCATCCTCAGAACAGGAACAGCCTGAGGGG
CTCTGGCCACCCCTAGCCTCACCTCTACATCCCCTGGAAGTACAAGGACTCATCTGTGGT
CCCTGCTTCTCCTCCCTCCCTGAACACCTTGGCTCTGTTCCCAAGCAGCTGGACTTCCAG
AGACATGGCTCAGATCCTGGATTTGCAGGGAGTTGGGGCCACTGA
Protein Properties
Number of Residues 994
Molecular Weight 109923.7
Theoretical pI 7.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 262-282
  • 299-319
  • 341-361
  • 371-391
  • 399-419
  • 491-511
Protein Sequence
>Potassium voltage-gated channel subfamily H member 6
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H252
UniProtKB/Swiss-Prot Entry Name KCNH6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF311913
GeneCard ID KCNH6
GenAtlas ID KCNH6
HGNC ID HGNC:18862
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bauer CK, Wulfsen I, Schafer R, Glassmeier G, Wimmers S, Flitsch J, Ludecke DK, Schwarz JR: HERG K(+) currents in human prolactin-secreting adenoma cells. Pflugers Arch. 2003 Feb;445(5):589-600. Epub 2002 Dec 6. [PubMed:12634931 ]