You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02249
Secondary Accession Numbers
  • 7734
Name Homer protein homolog 2
Synonyms
  1. Cupidin
  2. Homer-2
Gene Name HOMER2
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. May also couple GRM1 to PI3 kinase through its interaction with AGAP2. Isoforms can be differently regulated and may play an important role in maintaining the plasticity at glutamatergic synapses
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cell junction
  3. Cell junction
  4. synapse
  5. synapse
  6. postsynaptic cell membrane
  7. postsynaptic density
Gene Properties
Chromosome Location Chromosome:1
Locus 15q24.3
SNPs HOMER2
Gene Sequence
>1065 bp
ATGGGAGAACAGCCCATCTTCACCACCCGAGCGCATGTCTTCCAGATTGACCCCAACACC
AAGAAGAACTGGATGCCTGCGAGCAAGCAGGCGGTCACCGTTTCCTACTTCTATGATGTC
ACAAGGAACAGCTATCGGATCATCAGTGTGGACGGAGCCAAGGTGATCATAAACAGCACA
ATCACACCGAATATGACCTTCACCAAAACGTCACAGAAGTTTGGGCAGTGGGCCGACAGC
AGAGCCAACACAGTGTTTGGTTTGGGGTTTTCCTCTGAGCAGCAGCTGACAAAGTTTGCA
GAGAAATTCCAGGAGGTGAAAGAAGCTGCCAAGATAGCCAAAGACAAGACGCAGGAGAAA
ATCGAGACCTCAAGTAATCATTCCCAAGAATCTGGGCGTGAAACCCCATCTTCTACTCAG
GCATCCAGTGTCAACGGGACGGACGATGAAAAGGCCTCTCACGCCGGTCCAGCCAACACA
CACCTGAAGTCTGAGAATGACAAGCTGAAGATTGCCTTGACGCAGAGCGCAGCCAACGTG
AAGAAGTGGGAGATCGAGCTGCAGACCCTTCGGGAGAGCAATGCACGGCTGACCACAGCA
CTGCAGGAGTCGGCAGCCAGTGTGGAGCAGTGGAAGAGGCAGTTCTCCATCTGCCGTGAT
GAGAATGACCGGCTCCGCAACAAGATTGATGAGCTGGAAGAACAATGCAGTGAGATCAAC
AGAGAGAAGGAGAAGAACACGCAGCTGAAGAGGAGGATCGAGGAGCTGGAGGCAGAGCTC
CGAGAAAAGGAGACAGAGCTGAAAGATCTCCGAAAACAAAGTGAAATCATACCTCAGCTC
ATGTCAGAGTGCGAATATGTCTCTGAGAAGCTAGAGGCGGCAGAGAGAGACAATCAAAAC
CTGGAAGACAAAGTGCGTTCCTTAAAGACAGACATTGAGGAGAGCAAATACCGACAGCGC
CACCTGAAGGTGGAGTTGAAGAGCTTCCTGGAGGTGCTGGACGGGAAGATTGACGACCTG
CATGACTTCCGCCGAGGGCTCTCCAAGCTGGGCACCGATAACTAG
Protein Properties
Number of Residues 354
Molecular Weight 40627.0
Theoretical pI 6.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Homer protein homolog 2
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
GenBank ID Protein 46249351
UniProtKB/Swiss-Prot ID Q9NSB8
UniProtKB/Swiss-Prot Entry Name HOME2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_199330.1
GeneCard ID HOMER2
GenAtlas ID HOMER2
HGNC ID HGNC:17513
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Xiao B, Tu JC, Petralia RS, Yuan JP, Doan A, Breder CD, Ruggiero A, Lanahan AA, Wenthold RJ, Worley PF: Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins. Neuron. 1998 Oct;21(4):707-16. [PubMed:9808458 ]
  3. Soloviev MM, Ciruela F, Chan WY, McIlhinney RA: Molecular characterisation of two structurally distinct groups of human homers, generated by extensive alternative splicing. J Mol Biol. 2000 Feb 4;295(5):1185-200. [PubMed:10653696 ]
  4. Tu JC, Xiao B, Yuan JP, Lanahan AA, Leoffert K, Li M, Linden DJ, Worley PF: Homer binds a novel proline-rich motif and links group 1 metabotropic glutamate receptors with IP3 receptors. Neuron. 1998 Oct;21(4):717-26. [PubMed:9808459 ]