Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02287
Secondary Accession Numbers
  • 7772
Name Interleukin-3 precursor
Synonyms
  1. Hematopoietic growth factor
  2. IL-3
  3. MCGF
  4. Mast-cell growth factor
  5. Multipotential colony-stimulating factor
  6. P-cell-stimulating factor
Gene Name IL3
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes
Pathways
  • Fc Epsilon Receptor I Signaling in Mast Cells
Reactions Not Available
GO Classification
Component
extracellular region
Function
cytokine activity
hematopoietin/interferon-class (d200-domain) cytokine receptor binding
signal transducer activity
receptor binding
interleukin-3 receptor binding
growth factor activity
Process
response to biotic stimulus
defense response
response to stimulus
immune response
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs IL3
Gene Sequence
>459 bp
ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCT
CCCATGACCCAGACAACGTCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGAT
GAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAAT
GGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTC
AACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTC
CTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGAC
GGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCG
CAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTAG
Protein Properties
Number of Residues 152
Molecular Weight 17233.0
Theoretical pI 8.78
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions Not Available
Protein Sequence
>Interleukin-3 precursor
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
GenBank ID Protein 307059
UniProtKB/Swiss-Prot ID P08700
UniProtKB/Swiss-Prot Entry Name IL3_HUMAN
PDB IDs Not Available
GenBank Gene ID M14743
GeneCard ID IL3
GenAtlas ID IL3
HGNC ID HGNC:6011
References
General References
  1. Dorssers L, Burger H, Bot F, Delwel R, Geurts van Kessel AH, Lowenberg B, Wagemaker G: Characterization of a human multilineage-colony-stimulating factor cDNA clone identified by a conserved noncoding sequence in mouse interleukin-3. Gene. 1987;55(1):115-24. [PubMed:3497843 ]
  2. Otsuka T, Miyajima A, Brown N, Otsu K, Abrams J, Saeland S, Caux C, de Waal Malefijt R, de Vries J, Meyerson P, et al.: Isolation and characterization of an expressible cDNA encoding human IL-3. Induction of IL-3 mRNA in human T cell clones. J Immunol. 1988 Apr 1;140(7):2288-95. [PubMed:3127463 ]
  3. Yang YC, Ciarletta AB, Temple PA, Chung MP, Kovacic S, Witek-Giannotti JS, Leary AC, Kriz R, Donahue RE, Wong GG, et al.: Human IL-3 (multi-CSF): identification by expression cloning of a novel hematopoietic growth factor related to murine IL-3. Cell. 1986 Oct 10;47(1):3-10. [PubMed:3489530 ]
  4. Urdal DL, Price V, Sassenfeld HM, Cosman D, Gillis S, Park LS: Molecular characterization of colony-stimulating factors and their receptors: human interleukin-3. Ann N Y Acad Sci. 1989;554:167-76. [PubMed:2544122 ]
  5. Feng Y, Klein BK, McWherter CA: Three-dimensional solution structure and backbone dynamics of a variant of human interleukin-3. J Mol Biol. 1996 Jun 14;259(3):524-41. [PubMed:8676386 ]