You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02293
Secondary Accession Numbers
  • 7778
Name Metalloproteinase
Synonyms Not Available
Gene Name mmp20
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular matrix
extracellular matrix (sensu metazoa)
Function
endopeptidase activity
catalytic activity
hydrolase activity
metalloendopeptidase activity
peptidase activity
metallopeptidase activity
Process
physiological process
metabolism
macromolecule metabolism
protein metabolism
cellular protein metabolism
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs mmp20
Gene Sequence
>552 bp
ATGGACCCAGGGACAGTGGCCACCATGCGTAAGCCCCGCTGCTCCCTGCCTGACGTGCTG
GGGGTGGCGGGGCTGGTCAGGCGGCGTCGCCGGTACGCTCTGAGCGGCAGCGTGTGGAAG
AAGCGAACCCTGACATGGAGGGTACGTTCCTTCCCCCAGAGCTCCCAGCTGAGCCAGGAG
ACCGTGCGGGTCCTCATGAGCTATGCCCTGATGGCCTGGGGCATGGAGTCAGGCCTCACA
TTTCATGAGGTGGATTCCCCCCAGGGCCAGGAGCCCGACATCCTCATCGACTTTGCCCGC
GCCTTCCACCAGGACAGCTACCCCTTCGACGGGTTGGGGGGCACCCTAGCCCATGCCTTC
TTCCCTGGGGAGCACCCCATCTCCGGGGACACTCACTTTGACGATGAGGAGACCTGGACT
TTTGGGTCAAAAGCCTCTCAGCAGCTGGAGCAGGAGCTGGCAGGCGGCTCACCGGTTGAT
GAGGAGCTGGGCTTCAGCCGGGGCTGGCGTGTGAATCCTCTGGGTCCTGGCAGTCCTGAG
CGCCTGAGCTGA
Protein Properties
Number of Residues 183
Molecular Weight 20354.0
Theoretical pI 6.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Metalloproteinase
MDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQE
TVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAF
FPGEHPISGDTHFDDEETWTFGSKASQQLEQELAGGSPVDEELGFSRGWRVNPLGPGSPE
RLS
GenBank ID Protein 2808657
UniProtKB/Swiss-Prot ID O43923
UniProtKB/Swiss-Prot Entry Name O43923_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ003147
GeneCard ID mmp20
GenAtlas ID mmp20
HGNC ID HGNC:14246
References
General References
  1. Bernot A, Heilig R, Clepet C, Smaoui N, Da Silva C, Petit JL, Devaud C, Chiannilkulchai N, Fizames C, Samson D, Cruaud C, Caloustian C, Gyapay G, Delpech M, Weissenbach J: A transcriptional Map of the FMF region. Genomics. 1998 Jun 1;50(2):147-60. [PubMed:9653642 ]