You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02315
Secondary Accession Numbers
  • 7800
Name Keratocan
Synonyms
  1. KTN
  2. Keratan sulfate proteoglycan keratocan
Gene Name KERA
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 12q22
SNPs KERA
Gene Sequence
>1059 bp
ATGGCAGGCACAATCTGTTTCATCATGTGGGTGTTATTCATAACAGACACTGTGTGGTCT
AGAAGTGTAAGGCAGGTCTATGAAGTACATGATTCAGATGATTGGACTATTCATGACTTC
GAGTGTCCCATGGAATGTTTCTGCCCACCCAGTTTTCCTACTGCTTTATATTGTGAAAAT
AGAGGTCTCAAAGAAATTCCTGCTATTCCTTCAAGAATTTGGTATCTTTATCTTCAAAAC
AACCTGATAGAAACCATTCCTGAGAAGCCATTCGAGAATGCCACCCAGCTAAGATGGATA
AATCTAAATAAGAACAAAATAACCAACTACGGAATTGAAAAAGGAGCCCTAAGCCAGCTG
AAGAAGTTGCTCTTCTTATTTCTGGAAGATAATGAGCTAGAGGAGGTACCTTCTCCATTG
CCAAGAAGTTTAGAACAATTACAATTAGCTAGAAATAAGGTGTCCAGAATTCCTCAAGGG
ACCTTTAGCAATCTGGAGAACCTGACCCTTCTTGACCTACAGAACAACAAATTAGTGGAC
AATGCCTTTCAAAGAGACACTTTTAAAGGACTCAAGAATCTCATGCAGCTAAACATGGCC
AAGAATGCCCTGAGGAATATGCCTCCAAGATTACCAGCCAATACAATGCAGTTGTTTTTA
GACAACAATTCCATTGAAGGAATACCAGAAAATTATTTTAATGTGATTCCTAAAGTGGCC
TTTTTGAGACTAAATCACAACAAACTGTCAGATGAGGGTCTCCCATCAAGAGGATTTGAT
GTATCATCAATTCTAGATCTTCAACTGTCGCACAATCAACTCACAAAGGTTCCCCGAATC
AGTGCTCATCTGCAGCACCTTCACCTTGATCATAACAAAATTAAAAGTGTGAATGTCTCT
GTAATATGTCCCAGCCCATCCATGCTGCCTGCAGAACGAGATTCCTTCAGTTATGGACCT
CATCTTCGCTACCTCCGTCTGGATGGAAATGAAATCAAACCACCAATTCCAATGGCTTTA
ATGACCTGCTTCAGACTTCTGCAGGCTGTCATTATTTAA
Protein Properties
Number of Residues 352
Molecular Weight 40508.5
Theoretical pI 7.53
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • None
Protein Sequence
>Keratocan
MAGTICFIMWVLFITDTVWSRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCEN
RGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL
KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVD
NAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVA
FLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVS
VICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVII
GenBank ID Protein 3132827
UniProtKB/Swiss-Prot ID O60938
UniProtKB/Swiss-Prot Entry Name KERA_HUMAN
PDB IDs Not Available
GenBank Gene ID AF063301
GeneCard ID KERA
GenAtlas ID KERA
HGNC ID HGNC:6309
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  3. Tasheva ES, Funderburgh JL, Funderburgh ML, Corpuz LM, Conrad GW: Structure and sequence of the gene encoding human keratocan. DNA Seq. 1999;10(1):67-74. [PubMed:10565548 ]
  4. Pellegata NS, Dieguez-Lucena JL, Joensuu T, Lau S, Montgomery KT, Krahe R, Kivela T, Kucherlapati R, Forsius H, de la Chapelle A: Mutations in KERA, encoding keratocan, cause cornea plana. Nat Genet. 2000 May;25(1):91-5. [PubMed:10802664 ]
  5. Wentz-Hunter K, Cheng EL, Ueda J, Sugar J, Yue BY: Keratocan expression is increased in the stroma of keratoconus corneas. Mol Med. 2001 Jul;7(7):470-7. [PubMed:11683372 ]
  6. Lehmann OJ, El-ashry MF, Ebenezer ND, Ocaka L, Francis PJ, Wilkie SE, Patel RJ, Ficker L, Jordan T, Khaw PT, Bhattacharya SS: A novel keratocan mutation causing autosomal recessive cornea plana. Invest Ophthalmol Vis Sci. 2001 Dec;42(13):3118-22. [PubMed:11726611 ]