Hmdb loader
Survey

Showing Protein Eosinophil cationic protein precursor (HMDBP02316)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP02316
Secondary Accession Numbers
  • 7801
Name Eosinophil cationic protein precursor
Synonyms
  1. ECP
  2. RNase 3
  3. Ribonuclease 3
Gene Name RNASE3
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
nucleic acid binding
nuclease activity
endonuclease activity
endoribonuclease activity
endoribonuclease activity, producing 3'-phosphomonoesters
pancreatic ribonuclease activity
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:14
Locus 14q24-q31
SNPs RNASE3
Gene Sequence 
>483 bp
ATGGTTCCAAAACTGTTCACTTCCCAAATTTGTCTGCTTCTTCTGTTGGGGCTTATGGGT
GTGGAGGGCTCACTCCATGCCAGACCCCCACAGTTTACGAGGGCTCAGTGGTTTGCCATC
CAGCACATCAGTCTGAACCCCCCTCGATGCACCATTGCAATGCGGGCAATTAACAATTAT
CGATGGCGTTGCAAAAACCAAAATACTTTTCTTCGTACAACTTTTGCTAATGTAGTTAAT
GTTTGTGGTAACCAAAGTATACGCTGCCCTCATAACAGAACTCTCAACAATTGTCATCGG
AGTAGATTCCGGGTGCCTTTACTCCACTGTGACCTCATAAATCCAGGTGCACAGAATATT
TCAAACTGCAGGTATGCAGACAGACCAGGAAGGAGGTTCTATGTAGTTGCATGTGACAAC
AGAGATCCACGGGATTCTCCACGGTATCCTGTGGTTCCAGTTCACCTGGATACCACCATC
TAA
Protein Properties
Number of Residues 160
Molecular Weight 18386.0
Theoretical pI 10.33
Pfam Domain Function
Signals
  • 1-27
Transmembrane Regions Not Available
Protein Sequence 
>Eosinophil cationic protein precursor
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
GenBank ID Protein 31077
UniProtKB/Swiss-Prot ID P12724
UniProtKB/Swiss-Prot Entry Name ECP_HUMAN
PDB IDs
GenBank Gene ID X15161
GeneCard ID RNASE3
GenAtlas ID RNASE3
HGNC ID HGNC:10046
References
General References
  1. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  2. Barker RL, Loegering DA, Ten RM, Hamann KJ, Pease LR, Gleich GJ: Eosinophil cationic protein cDNA. Comparison with other toxic cationic proteins and ribonucleases. J Immunol. 1989 Aug 1;143(3):952-5. [PubMed:2745977 ]
  3. Hamann KJ, Ten RM, Loegering DA, Jenkins RB, Heise MT, Schad CR, Pease LR, Gleich GJ, Barker RL: Structure and chromosome localization of the human eosinophil-derived neurotoxin and eosinophil cationic protein genes: evidence for intronless coding sequences in the ribonuclease gene superfamily. Genomics. 1990 Aug;7(4):535-46. [PubMed:2387583 ]
  4. Zhang J, Rosenberg HF: Sequence variation at two eosinophil-associated ribonuclease loci in humans. Genetics. 2000 Dec;156(4):1949-58. [PubMed:11102386 ]
  5. Gleich GJ, Loegering DA, Bell MP, Checkel JL, Ackerman SJ, McKean DJ: Biochemical and functional similarities between human eosinophil-derived neurotoxin and eosinophil cationic protein: homology with ribonuclease. Proc Natl Acad Sci U S A. 1986 May;83(10):3146-50. [PubMed:3458170 ]
  6. Gabay JE, Scott RW, Campanelli D, Griffith J, Wilde C, Marra MN, Seeger M, Nathan CF: Antibiotic proteins of human polymorphonuclear leukocytes. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5610-4. [PubMed:2501794 ]
  7. Rosenberg HF, Ackerman SJ, Tenen DG: Human eosinophil cationic protein. Molecular cloning of a cytotoxin and helminthotoxin with ribonuclease activity. J Exp Med. 1989 Jul 1;170(1):163-76. [PubMed:2473157 ]
  8. Boix E, Leonidas DD, Nikolovski Z, Nogues MV, Cuchillo CM, Acharya KR: Crystal structure of eosinophil cationic protein at 2.4 A resolution. Biochemistry. 1999 Dec 21;38(51):16794-801. [PubMed:10606511 ]
  9. Mallorqui-Fernandez G, Pous J, Peracaula R, Aymami J, Maeda T, Tada H, Yamada H, Seno M, de Llorens R, Gomis-Ruth FX, Coll M: Three-dimensional crystal structure of human eosinophil cationic protein (RNase 3) at 1.75 A resolution. J Mol Biol. 2000 Jul 28;300(5):1297-307. [PubMed:10903870 ]
  10. Mohan CG, Boix E, Evans HR, Nikolovski Z, Nogues MV, Cuchillo CM, Acharya KR: The crystal structure of eosinophil cationic protein in complex with 2',5'-ADP at 2.0 A resolution reveals the details of the ribonucleolytic active site. Biochemistry. 2002 Oct 8;41(40):12100-6. [PubMed:12356310 ]