Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.

Showing Protein Myoglobin (HMDBP02370)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP02370
Secondary Accession Numbers
  • 7860
Name Myoglobin
Synonyms Not Available
Gene Name MB
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
heme binding
oxygen binding
Process
establishment of localization
transport
gas transport
oxygen transport
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs MB
Gene Sequence 
>465 bp
ATGGGGCTCAGCGACGGGGAATGGCAGTTGGTGCTGAACGTCTGGGGGAAGGTGGAGGCT
GACATCCCAGGCCATGGGCAGGAAGTCCTCATCAGGCTCTTTAAGGGTCACCCAGAGACT
CTGGAGAAGTTTGACAAGTTCAAGCACCTGAAGTCAGAGGACGAGATGAAGGCATCTGAG
GACTTAAAGAAGCATGGTGCCACTGTGCTCACCGCCCTGGGTGGCATCCTTAAGAAGAAG
GGGCATCATGAGGCAGAGATTAAGCCCCTGGCACAGTCGCATGCCACCAAGCACAAGATC
CCCGTGAAGTACCTGGAGTTCATCTCGGAATGCATCATCCAGGTTCTGCAGAGCAAGCAT
CCCGGGGACTTTGGTGCTGATGCCCAGGGGGCCATGAACAAGGCCCTGGAGCTGTTCCGG
AAGGACATGGCCTCCAACTACAAGGAGCTGGGCTTCCAGGGCTAG
Protein Properties
Number of Residues 154
Molecular Weight 17183.7
Theoretical pI 7.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
GenBank ID Protein 47678563
UniProtKB/Swiss-Prot ID P02144
UniProtKB/Swiss-Prot Entry Name MYG_HUMAN
PDB IDs
GenBank Gene ID CR456516
GeneCard ID MB
GenAtlas ID MB
HGNC ID HGNC:6915
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Corbett JM, Wheeler CH, Baker CS, Yacoub MH, Dunn MJ: The human myocardial two-dimensional gel protein database: update 1994. Electrophoresis. 1994 Nov;15(11):1459-65. [PubMed:7895732 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Weller P, Jeffreys AJ, Wilson V, Blanchetot A: Organization of the human myoglobin gene. EMBO J. 1984 Feb;3(2):439-46. [PubMed:6571704 ]
  6. Akaboshi E: Cloning of the human myoglobin gene. Gene. 1985;33(3):241-9. [PubMed:2989088 ]
  7. Herrera AE, Lehmann H: Primary structure of human myoglobin. Nat New Biol. 1971 Aug 4;232(31):149-52. [PubMed:5285572 ]
  8. Romero Herrera AE, Lehmann H: The myoglobin of primates. I. Hylobates agilis (gibbon). Biochim Biophys Acta. 1971 Dec 28;251(3):482-8. [PubMed:11452891 ]
  9. Romero Herrera AE, Lehmann H: The myoglobin of primates. II. Pan Troglodytes (chimpanzee). Biochim Biophys Acta. 1972 Aug 31;278(1):62-7. [PubMed:4627044 ]
  10. Boulton FE, Huntsman RG, Lorkin PA, Lehmann H: Abnormal human myoglobin: 53 (D4) glutamic acid--lysine. Nature. 1969 Aug 23;223(5208):832-3. [PubMed:5805522 ]
  11. Boulton FE, Huntsman RG, Romero Herrera A, Lorkin PA, Lehmann H: The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine--tryptophan. Biochim Biophys Acta. 1971 Mar 23;229(3):716-9. [PubMed:5555219 ]
  12. Boulton FE, Huntsman RG, Romero Herrera AE, Lorkin PA, Lehmann H: A human myoglobin variant 133 (H-10)lysine--asparagine. Biochim Biophys Acta. 1971 Mar 23;229(3):871-6. [PubMed:5555226 ]
  13. Boulton FE, Huntsman RG, Yawson GI, Romero Herrera AE, Lorkin PA, Lehmann H: The second variant of human myoglobin; 138(H16) arginine leads to glutamine. Br J Haematol. 1971 Jan;20(1):69-74. [PubMed:5540041 ]
  14. Hubbard SR, Hendrickson WA, Lambright DG, Boxer SG: X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution. J Mol Biol. 1990 May 20;213(2):215-8. [PubMed:2342104 ]