Hmdb loader

Showing Protein Interleukin-8 (HMDBP02377)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP02377
Secondary Accession Numbers
  • 7867
Name Interleukin-8
Synonyms
  1. (Ala-IL-8)77
  2. (Ser-IL-8)72
  3. C-X-C motif chemokine 8
  4. Emoctakin
  5. GCP-1
  6. GCP/IL-8 protein I
  7. GCP/IL-8 protein II
  8. GCP/IL-8 protein III
  9. GCP/IL-8 protein IV
  10. GCP/IL-8 protein V
  11. GCP/IL-8 protein VI
  12. Granulocyte chemotactic protein 1
  13. IL-8
  14. IL-8(1-77)
  15. IL-8(5-77)
  16. IL-8(6-77)
  17. IL-8(7-77)
  18. IL-8(8-77)
  19. IL-8(9-77)
  20. IL8/NAP1 form I
  21. IL8/NAP1 form II
  22. IL8/NAP1 form III
  23. IL8/NAP1 form IV
  24. IL8/NAP1 form V
  25. IL8/NAP1 form VI
  26. Interleukin-8
  27. LYNAP
  28. Lymphocyte-derived neutrophil-activating factor
  29. MDNCF
  30. MDNCF-a
  31. MDNCF-b
  32. MDNCF-c
  33. MONAP
  34. Monocyte-derived neutrophil chemotactic factor
  35. Monocyte-derived neutrophil-activating peptide
  36. NAF
  37. NAP-1
  38. Neutrophil-activating factor
  39. Neutrophil-activating protein 1
  40. Protein 3-10C
  41. T-cell chemotactic factor
Gene Name IL8
Protein Type Enzyme
Biological Properties
General Function Involved in cytokine activity
Specific Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
cytokine activity
chemokine activity
binding
protein binding
receptor binding
Process
immune system process
immune response
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:4
Locus 4q13-q21
SNPs IL8
Gene Sequence 
>300 bp
ATGACTTCCAAGCTGGCCGTGGCTCTCTTGGCAGCCTTCCTGATTTCTGCAGCTCTGTGT
GAAGGTGCAGTTTTGCCAAGGAGTGCTAAAGAACTTAGATGTCAGTGCATAAAGACATAC
TCCAAACCTTTCCACCCCAAATTTATCAAAGAACTGAGAGTGATTGAGAGTGGACCACAC
TGCGCCAACACAGAAATTATTGTAAAGCTTTCTGATGGAAGAGAGCTCTGTCTGGACCCC
AAGGAAAACTGGGTGCAGAGGGTTGTGGAGAAGTTTTTGAAGAGGGCTGAGAATTCATAA
Protein Properties
Number of Residues 99
Molecular Weight 11098.0
Theoretical pI 9.09
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • None
Protein Sequence 
>Interleukin-8
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P10145
UniProtKB/Swiss-Prot Entry Name IL8_HUMAN
PDB IDs
GenBank Gene ID M17017
GeneCard ID IL8
GenAtlas ID IL8
HGNC ID HGNC:6025
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Golds EE, Mason P, Nyirkos P: Inflammatory cytokines induce synthesis and secretion of gro protein and a neutrophil chemotactic factor but not beta 2-microglobulin in human synovial cells and fibroblasts. Biochem J. 1989 Apr 15;259(2):585-8. [PubMed:2655583 ]
  4. Schmid J, Weissmann C: Induction of mRNA for a serine protease and a beta-thromboglobulin-like protein in mitogen-stimulated human leukocytes. J Immunol. 1987 Jul 1;139(1):250-6. [PubMed:2953813 ]
  5. Matsushima K, Morishita K, Yoshimura T, Lavu S, Kobayashi Y, Lew W, Appella E, Kung HF, Leonard EJ, Oppenheim JJ: Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction of MDNCF mRNA by interleukin 1 and tumor necrosis factor. J Exp Med. 1988 Jun 1;167(6):1883-93. [PubMed:3260265 ]
  6. Mukaida N, Shiroo M, Matsushima K: Genomic structure of the human monocyte-derived neutrophil chemotactic factor IL-8. J Immunol. 1989 Aug 15;143(4):1366-71. [PubMed:2663993 ]
  7. Kowalski J, Denhardt DT: Regulation of the mRNA for monocyte-derived neutrophil-activating peptide in differentiating HL60 promyelocytes. Mol Cell Biol. 1989 May;9(5):1946-57. [PubMed:2664463 ]
  8. Hotta K, Hayashi K, Ishikawa J, Tagawa M, Hashimoto K, Mizuno S, Suzuki K: Coding region structure of interleukin-8 gene of human lung giant cell carcinoma LU65C cells that produce LUCT/interleukin-8: homogeneity in interleukin-8 genes. Immunol Lett. 1990 Jun;24(3):165-9. [PubMed:2200751 ]
  9. Van Damme J, Van Beeumen J, Conings R, Decock B, Billiau A: Purification of granulocyte chemotactic peptide/interleukin-8 reveals N-terminal sequence heterogeneity similar to that of beta-thromboglobulin. Eur J Biochem. 1989 May 1;181(2):337-44. [PubMed:2523801 ]
  10. Van Damme J, Rampart M, Conings R, Decock B, Van Osselaer N, Willems J, Billiau A: The neutrophil-activating proteins interleukin 8 and beta-thromboglobulin: in vitro and in vivo comparison of NH2-terminally processed forms. Eur J Immunol. 1990 Sep;20(9):2113-8. [PubMed:2145175 ]
  11. Yoshimura T, Robinson EA, Appella E, Matsushima K, Showalter SD, Skeel A, Leonard EJ: Three forms of monocyte-derived neutrophil chemotactic factor (MDNCF) distinguished by different lengths of the amino-terminal sequence. Mol Immunol. 1989 Jan;26(1):87-93. [PubMed:2648135 ]
  12. Suzuki K, Miyasaka H, Ota H, Yamakawa Y, Tagawa M, Kuramoto A, Mizuno S: Purification and partial primary sequence of a chemotactic protein for polymorphonuclear leukocytes derived from human lung giant cell carcinoma LU65C cells. J Exp Med. 1989 Jun 1;169(6):1895-901. [PubMed:2659722 ]
  13. Schroder JM: Biochemical and biological characterization of NAP-1/IL-8-related cytokines in lesional psoriatic scale. Adv Exp Med Biol. 1991;305:97-107. [PubMed:1755384 ]
  14. Suzuki K, Yamakawa Y, Matsuo Y, Kamiya T, Minowada J, Mizuno S: Isolation and amino acid sequence of a chemotactic protein, LECT/interleukin 8, from a human myeloid leukemia cell line, ML-1. Immunol Lett. 1993 Apr;36(1):71-81. [PubMed:8344717 ]
  15. Gregory H, Young J, Schroder JM, Mrowietz U, Christophers E: Structure determination of a human lymphocyte derived neutrophil activating peptide (LYNAP). Biochem Biophys Res Commun. 1988 Mar 15;151(2):883-90. [PubMed:3279957 ]
  16. Yoshimura T, Matsushima K, Tanaka S, Robinson EA, Appella E, Oppenheim JJ, Leonard EJ: Purification of a human monocyte-derived neutrophil chemotactic factor that has peptide sequence similarity to other host defense cytokines. Proc Natl Acad Sci U S A. 1987 Dec;84(24):9233-7. [PubMed:3480540 ]
  17. Walz A, Peveri P, Aschauer H, Baggiolini M: Purification and amino acid sequencing of NAF, a novel neutrophil-activating factor produced by monocytes. Biochem Biophys Res Commun. 1987 Dec 16;149(2):755-61. [PubMed:3322281 ]
  18. Hebert CA, Luscinskas FW, Kiely JM, Luis EA, Darbonne WC, Bennett GL, Liu CC, Obin MS, Gimbrone MA Jr, Baker JB: Endothelial and leukocyte forms of IL-8. Conversion by thrombin and interactions with neutrophils. J Immunol. 1990 Nov 1;145(9):3033-40. [PubMed:2212672 ]
  19. Clark-Lewis I, Moser B, Walz A, Baggiolini M, Scott GJ, Aebersold R: Chemical synthesis, purification, and characterization of two inflammatory proteins, neutrophil activating peptide 1 (interleukin-8) and neutrophil activating peptide. Biochemistry. 1991 Mar 26;30(12):3128-35. [PubMed:2007144 ]
  20. Van den Steen PE, Proost P, Wuyts A, Van Damme J, Opdenakker G: Neutrophil gelatinase B potentiates interleukin-8 tenfold by aminoterminal processing, whereas it degrades CTAP-III, PF-4, and GRO-alpha and leaves RANTES and MCP-2 intact. Blood. 2000 Oct 15;96(8):2673-81. [PubMed:11023497 ]
  21. Schutyser E, Struyf S, Proost P, Opdenakker G, Laureys G, Verhasselt B, Peperstraete L, Van de Putte I, Saccani A, Allavena P, Mantovani A, Van Damme J: Identification of biologically active chemokine isoforms from ascitic fluid and elevated levels of CCL18/pulmonary and activation-regulated chemokine in ovarian carcinoma. J Biol Chem. 2002 Jul 5;277(27):24584-93. Epub 2002 Apr 26. [PubMed:11978786 ]
  22. Baggiolini M, Clark-Lewis I: Interleukin-8, a chemotactic and inflammatory cytokine. FEBS Lett. 1992 Jul 27;307(1):97-101. [PubMed:1639201 ]
  23. Struyf S, Proost P, Van Damme J: Regulation of the immune response by the interaction of chemokines and proteases. Adv Immunol. 2003;81:1-44. [PubMed:14711052 ]
  24. Clore GM, Appella E, Yamada M, Matsushima K, Gronenborn AM: Determination of the secondary structure of interleukin-8 by nuclear magnetic resonance spectroscopy. J Biol Chem. 1989 Nov 15;264(32):18907-11. [PubMed:2681204 ]
  25. Clore GM, Appella E, Yamada M, Matsushima K, Gronenborn AM: Three-dimensional structure of interleukin 8 in solution. Biochemistry. 1990 Feb 20;29(7):1689-96. [PubMed:2184886 ]
  26. Sticht H, Auer M, Schmitt B, Besemer J, Horcher M, Kirsch T, Lindley IJ, Rosch P: Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein. Eur J Biochem. 1996 Jan 15;235(1-2):26-35. [PubMed:8631339 ]
  27. Skelton NJ, Quan C, Reilly D, Lowman H: Structure of a CXC chemokine-receptor fragment in complex with interleukin-8. Structure. 1999 Feb 15;7(2):157-68. [PubMed:10368283 ]
  28. Baldwin ET, Franklin KA, Appella E, Yamada M, Matsushima K, Wlodawer A, Weber IT: Crystallization of human interleukin-8. A protein chemotactic for neutrophils and T-lymphocytes. J Biol Chem. 1990 Apr 25;265(12):6851-3. [PubMed:2182630 ]
  29. Clore GM, Gronenborn AM: Comparison of the solution nuclear magnetic resonance and crystal structures of interleukin-8. Possible implications for the mechanism of receptor binding. J Mol Biol. 1991 Feb 20;217(4):611-20. [PubMed:2005614 ]
  30. Baldwin ET, Weber IT, St Charles R, Xuan JC, Appella E, Yamada M, Matsushima K, Edwards BF, Clore GM, Gronenborn AM, et al.: Crystal structure of interleukin 8: symbiosis of NMR and crystallography. Proc Natl Acad Sci U S A. 1991 Jan 15;88(2):502-6. [PubMed:1988949 ]
  31. Gerber N, Lowman H, Artis DR, Eigenbrot C: Receptor-binding conformation of the "ELR" motif of IL-8: X-ray structure of the L5C/H33C variant at 2.35 A resolution. Proteins. 2000 Mar 1;38(4):361-7. [PubMed:10707023 ]