Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02381
Secondary Accession Numbers
  • 7871
Name Neuropeptide S receptor
Synonyms
  1. G-protein coupled receptor 154
  2. G-protein coupled receptor PGR14
  3. G-protein coupled receptor for asthma susceptibility
Gene Name NPSR1
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
vasopressin receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Isoform 9:Cytoplasm
Gene Properties
Chromosome Location Chromosome:7
Locus 7p14.3
SNPs NPSR1
Gene Sequence
>1116 bp
ATGCCAGCCAACTTCACAGAGGGCAGCTTCGATTCCAGTGGGACCGGGCAGACGCTGGAT
TCTTCCCCAGTGGCTTGCACTGAAACAGTGACTTTTACTGAAGTGGTGGAAGGAAAGGAA
TGGGGTTCCTTCTACTACTCCTTTAAGACTGAGCAATTGATAACTCTGTGGGTCCTCTTT
GTTTTTACCATTGTTGGAAACTCCGTTGTGCTTTTTTCCACATGGAGGAGAAAGAAGAAG
TCAAGAATGACCTTCTTTGTGACTCAGCTGGCCATCACAGATTCTTTCACAGGACTGGTC
AACATCTTGACAGATATTAATTGGCGATTCACTGGAGACTTCACGGCACCTGACCTGGTT
TGCCGAGTGGTCCGCTATTTGCAGGTTGTGCTGCTCTACGCCTCTACCTACGTCCTGGTG
TCCCTCAGCATAGACAGATACCATGCCATCGTCTACCCCATGAAGTTCCTTCAAGGAGAA
AAGCAAGCCAGGGTCCTCATTGTGATCGCCTGGAGCCTGTCTTTTCTGTTCTCCATTCCC
ACCCTGATCATATTTGGGAAGAGGACACTGTCCAACGGTGAAGTGCAGTGCTGGGCCCTG
TGGCCTGACGACTCCTACTGGACCCCATACATGACCATCGTGGCCTTCCTGGTGTACTTC
ATCCCTCTGACAATCATCAGCATCATGTATGGCATTGTGATCCGAACTATTTGGATTAAA
AGCAAAACCTACGAAACAGTGATTTCCAACTGCTCAGATGGGAAACTGTGCAGCAGCTAT
AACCGAGGACTCATCTCAAAGGCAAAAATCAAGGCTATCAAGTATAGCATCATCATCATT
CTTGCCTTCATCTGCTGTTGGAGTCCATACTTCCTGTTTGACATTTTGGACAATTTCAAC
CTCCTTCCAGACACCCAGGAGCGTTTCTATGCCTCTGTGATCATTCAGAACCTGCCAGCA
TTGAATAGTGCCATCAACCCCCTCATCTACTGTGTCTTCAGCAGCTCCATCTCTTTCCCC
TGCAGGGAGCAAAGATCACAGGATTCCAGAATGACGTTCCGGGAGAGAACTGAGAGGCAT
GAGATGCAGATTCTGTCCAAGCCAGAATTCATCTAG
Protein Properties
Number of Residues 371
Molecular Weight 42686.3
Theoretical pI 8.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 53-73
  • 83-103
  • 124-144
  • 165-185
  • 213-233
  • 276-296
  • 313-333
Protein Sequence
>Neuropeptide S receptor
MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
EMQILSKPEFI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6W5P4
UniProtKB/Swiss-Prot Entry Name NPSR1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY310326
GeneCard ID NPSR1
GenAtlas ID NPSR1
HGNC ID HGNC:23631
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Laitinen T, Polvi A, Rydman P, Vendelin J, Pulkkinen V, Salmikangas P, Makela S, Rehn M, Pirskanen A, Rautanen A, Zucchelli M, Gullsten H, Leino M, Alenius H, Petays T, Haahtela T, Laitinen A, Laprise C, Hudson TJ, Laitinen LA, Kere J: Characterization of a common susceptibility locus for asthma-related traits. Science. 2004 Apr 9;304(5668):300-4. [PubMed:15073379 ]
  4. Vendelin J, Pulkkinen V, Rehn M, Pirskanen A, Raisanen-Sokolowski A, Laitinen A, Laitinen LA, Kere J, Laitinen T: Characterization of GPRA, a novel G protein-coupled receptor related to asthma. Am J Respir Cell Mol Biol. 2005 Sep;33(3):262-70. Epub 2005 Jun 9. [PubMed:15947423 ]
  5. Melen E, Bruce S, Doekes G, Kabesch M, Laitinen T, Lauener R, Lindgren CM, Riedler J, Scheynius A, van Hage-Hamsten M, Kere J, Pershagen G, Wickman M, Nyberg F: Haplotypes of G protein-coupled receptor 154 are associated with childhood allergy and asthma. Am J Respir Crit Care Med. 2005 May 15;171(10):1089-95. Epub 2005 Feb 11. [PubMed:15710598 ]
  6. Kormann MS, Carr D, Klopp N, Illig T, Leupold W, Fritzsch C, Weiland SK, von Mutius E, Kabesch M: G-Protein-coupled receptor polymorphisms are associated with asthma in a large German population. Am J Respir Crit Care Med. 2005 Jun 15;171(12):1358-62. Epub 2005 Mar 11. [PubMed:15764725 ]