Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02399
Secondary Accession Numbers
  • 7892
  • HMDBP03624
Name Sodium- and chloride-dependent glycine transporter 1
Synonyms
  1. GlyT-1
  2. GlyT1
  3. Solute carrier family 6 member 9
Gene Name SLC6A9
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
organic acid:sodium symporter activity
sodium:amino acid symporter activity
transporter activity
organic acid transmembrane transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
glycine:sodium symporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 1
Locus 1p33
SNPs SLC6A9
Gene Sequence
>2121 bp
ATGAGCGGCGGAGACACGCGGGCTGCGATCGCTCGCCCCAGGATGGCCGCGGCTCATGGA
CCTGTGGCCCCCTCTTCCCCAGAACAGGTGACGCTTCTCCCTGTTCAGAGATCCTTCTTC
CTGCCACCCTTTTCTGGAGCCACTCCCTCTACTTCCCTAGCAGAGTCTGTCCTCAAAGTC
TGGCATGGGGCCTACAACTCTGGTCTCCTTCCCCAACTCATGGCCCAGCACTCCCTAGCC
ATGGCCCAGAATGGTGCTGTGCCCAGCGAGGCCACCAAGAGGGACCAGAACCTCAAACGG
GGCAACTGGGGCAACCAGATCGAGTTTGTACTGACGAGCGTGGGCTATGCCGTGGGCCTG
GGCAATGTCTGGCGCTTCCCATACCTCTGCTATCGCAACGGGGGAGGCGCCTTCATGTTC
CCCTACTTCATCATGCTCATCTTCTGCGGGATCCCCCTCTTCTTCATGGAGCTCTCCTTC
GGCCAGTTTGCAAGCCAGGGGTGCCTGGGGGTCTGGAGGATCAGCCCCATGTTCAAAGGA
GTGGGCTATGGTATGATGGTGGTGTCCACCTACATCGGCATCTACTACAATGTGGTCATC
TGCATCGCCTTCTACTACTTCTTCTCGTCCATGACGCACGTGCTGCCCTGGGCCTACTGC
AATAACCCCTGGAACACGCATGACTGCGCCGGTGTACTGGACGCCTCCAACCTCACCAAT
GGCTCTCGGCCAGCCGCCTTGCCCAGCAACCTCTCCCACCTGCTCAACCACAGCCTCCAG
AGGACCAGCCCCAGCGAGGAGTACTGGAGGCTGTACGTGCTGAAGCTGTCAGATGACATT
GGGAACTTTGGGGAGGTGCGGCTGCCCCTCCTTGGCTGCCTCGGTGTCTCCTGGTTGGTC
GTCTTCCTCTGCCTCATCCGAGGGGTCAAGTCTTCAGGGAAAGTGGTGTACTTCACGGCC
ACGTTCCCCTACGTGGTGCTGACCATTCTGTTTGTCCGCGGAGTGACCCTGGAGGGAGCC
TTTGACGGCATCATGTACTACCTAACCCCGCAGTGGGACAAGATCCTGGAGGCCAAGGTG
TGGGGTGATGCTGCCTCCCAGATCTTCTACTCACTGGGCTGCGCGTGGGGAGGCCTCATC
ACCATGGCTTCCTACAACAAGTTCCACAATAACTGTTACCGGGACAGTGTCATCATCAGC
ATCACCAACTGTGCCACCAGCGTCTATGCTGGCTTCGTCATCTTCTCCATCCTCGGCTTC
ATGGCCAATCACCTGGGCGTGGATGTGTCCCGTGTGGCAGACCACGGCCCTGGCCTGGCC
TTCGTGGCTTACCCCGAGGCCCTCACACTACTTCCCATCTCCCCGCTGTGGTCTCTGCTC
TTCTTCTTCATGCTTATCCTGCTGGGGCTGGGCACTCAGTTCTGCCTCCTGGAGACGCTG
GTCACAGCCATTGTGGATGAGGTGGGGAATGAGTGGATCCTGCAGAAAAAGACCTATGTG
ACCTTGGGCGTGGCTGTGGCTGGCTTCCTGCTGGGCATCCCCCTCACCAGCCAGGCAGGC
ATCTATTGGCTGCTGCTGATGGACAACTATGCGGCCAGCTTCTCCTTGGTGGTCATCTCC
TGCATCATGTGTGTGGCCATCATGTACATCTACGGGCACCGGAACTACTTCCAGGACATC
CAGATGATGCTGGGATTCCCACCACCCCTCTTCTTTCAGATCTGCTGGCGCTTCGTCTCT
CCCGCCATCATCTTCTTTATTCTAGTTTTCACTGTGATCCAGTACCAGCCGATCACCTAC
AACCACTACCAGTACCCAGGCTGGGCCGTGGCCATTGGCTTCCTCATGGCTCTGTCCTCC
GTCCTCTGCATCCCCCTCTACGCCATGTTCCGGCTCTGCCGCACAGACGGGGACACCCTC
CTCCAGCGTTTGAAAAATGCCACAAAGCCAAGCAGAGACTGGGGCCCTGCCCTCCTGGAG
CACCGGACAGGGCGCTACGCCCCCACCATAGCCCCCTCTCCTGAGGACGGCTTCGAGGTC
CAGCCACTGCACCCGGACAAGGCGCAGATCCCCATTGTGGGCAGTAATGGCTCCAGCCGC
CTCCAGGACTCCCGGATATGA
Protein Properties
Number of Residues 706
Molecular Weight 70582.02
Theoretical pI 7.921
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium- and chloride-dependent glycine transporter 1
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
GenBank ID Protein 67782315
UniProtKB/Swiss-Prot ID P48067
UniProtKB/Swiss-Prot Entry Name SC6A9_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_201649.2
GeneCard ID SLC6A9
GenAtlas ID SLC6A9
HGNC ID HGNC:11056
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Kim KM, Kingsmore SF, Han H, Yang-Feng TL, Godinot N, Seldin MF, Caron MG, Giros B: Cloning of the human glycine transporter type 1: molecular and pharmacological characterization of novel isoform variants and chromosomal localization of the gene in the human and mouse genomes. Mol Pharmacol. 1994 Apr;45(4):608-17. [PubMed:8183239 ]