Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02426
Secondary Accession Numbers
  • 7920
Name Early endosome antigen 1
Synonyms
  1. Endosome-associated protein p162
  2. Zinc finger FYVE domain-containing protein 2
Gene Name EEA1
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in endosomal trafficking
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Early endosome membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12q22
SNPs EEA1
Gene Sequence
>4233 bp
ATGTTAAGGAGGATTTTACAGAGGACTCCTGGGAGAGTTGGCTCTCAAGGTTCTGATTTA
GATTCATCAGCAACTCCTATAAACACAGTGGACGTCAATAATGAAAGCTCTTCAGAAGGT
TTCATATGTCCCCAGTGTATGAAATCTCTTGGATCTGCTGATGAACTTTTCAAACATTAT
GAAGCTGTTCATGATGCTGGTAATGACTCAGGTCATGGAGGAGAGTCTAATCTTGCTTTG
AAGCGAGATGATGTAACACTGCTCAGACAAGAGGTCCAAGACCTACAGGCTTCACTTAAG
GAAGAAAAATGGTACTCGGAAGAATTAAAGAAGGAATTAGAAAAATATCAAGGGCTGCAG
CAGCAAGAGGCCAAACCTGATGGGTTGGTGACTGATTCATCAGCAGAACTACAGTCTTTG
GAACAGCAATTAGAAGAAGCCCAAACAGAAAATTTTAATATTAAGCAAATGAAAGACTTA
TTTGAACAGAAAGCAGCCCAACTTGCTACTGAAATTGCAGATATAAAGTCAAAGTATGAT
GAAGAAAGGAGTCTTCGAGAAGCTGCTGAACAAAAAGTGACACGTCTGACAGAAGAATTA
AACAAAGAGGCAACTGTAATTCAAGATCTGAAGACGGAACTGCTTCAGAGACCTGGTATA
GAAGATGTTGCCGTGCTAAAGAAAGAACTGGTCCAAGTTCAAACACTAATGGATAACATG
ACCTTGGAACGTGAGCGAGAATCTGAAAAACTCAAAGATGAATCGAAAAAATTCGAGTCA
CAATATGCTAGCTCAGAGGCCACAATAAGCCAGCTAAGGAGTGAACTGTCCAAAGGCCCC
CAGGAAGTTCGTGTATATGTACAGGAACTACAAAAACTGAAAAGTTCAGTTAATGAATTA
ACACAAAAAAATCAGACCTTGACAGAAAACTTGCTGAAAAAAGAACAAGACTATACTAAG
TTAGAGGAGAAACATAATGAAGAATCTGTGAGTAAAAAGAATATTCAGGCAACCCTTCAT
CAAAAAGACCTAGATTGTCAACAGCTTCAGTCAAGATTGTCTGCATCTGAAACCTCACTG
CATAGAATACATGTAGAACTAAGTGAAAAAGGAGAAGCTACTCAAAAGCTCAAAGAAGAA
TTATCTGAGGTAGAGACCAAGTACCAGCATCTAAAGGCGGAGTTTAAGCAGCTACAACAA
CAGAGAGAAGAAAAGGAGCAGCATGGGTTACAACTCCAAAGTGAAATTAATCAATTACAT
AGCAAACTTCTGGAGACAGAGCGCCAACTAGGGGAAGCTCATGGTAGGCTGAAGGAACAG
AGACAGCTTTCAAGTGAAAAGTTGATGGATAAAGAACAACAAGTGGCTGATTTACAACTC
AAACTTTCTCGGTTAGAAGAGCAGTTGAAGGAAAAAGTTACAAATTCTACAGAATTGCAG
CATCAATTAGATAAAACAAAGCAACAGCATCAAGAACAACAGGCTCTTCAGCAAAGCACC
ACGGCAAAACTTCGAGAAGCTCAGAATGATTTGGAACAAGTTCTACGTCAAATTGGCGAA
AAGGACCAAAAGATCCAGAACCTTGAAGCTTTATTACAGAAGAGTAAAGAAAATATTTCA
TTACTAGAAAAAGAAAGAGAAGATCTTTATGCAAAAATTCAGGCTGGTGAAGGAGAGACT
GCTGTTCTTAACCAGTTACAAGAAAAAAACCATACACTACAGGACGAAGTAACTCAACTA
ACAGAGAACGTGAAGAATCAGTCAGAAAGTCATAAACAAGCCCAGGAGAATTTGCATGAC
CAGGTACAAGAGCAGAAGGCACATCTTAGAGCTGCACAAGACCGTGTCCTTTCCCTAGAA
ACTAGTGTCAATGAATTAAATAGTCAATTAAATGAAAGCAAGGAGAAGGTCTCCCAGCTT
GACATACAGATTAAAGCCAAAACCGAACTATTACTATCAGCAGAAGCAGCAAAAACTGCT
CAAAGAGCTGATCTTCAGAATCATTTGGACACAGCTCAAAATGCATTACAAGATAAACAC
CAGGAGTTAAATAAGATTACTACTCAGTTGGATCAGGTCACTGCAAAGTTACAAGACAAG
CAAGAACATTGCAGTCAGCTGGAAAGTCATCTTAAAGAATATAAAGAGAAATACCTCTCT
TTAGAACAGAAAACCGAAGAGCTAGAAGGTCAAATTAAGAAACTAGAAGCTGATAGTCTT
GAAGTTAAAGCAAGCAAGGAGCAGGCTTTGCAAGATCTACAACAGCAAAGACAGCTGAAC
ACAGATTTAGAGCTCAGAGCCACAGAATTGAGTAAACAACTTGAAATGGAGAAGGAAATA
GTATCCAGTACAAGATTGGATCTACAGAAAAAATCTGAAGCCCTTGAAAGTATCAAGCAA
AAGCTTACCAAGCAAGAGGAAGAAAAACAAATCCTGAAACAAGATTTTGAAACTTTAAGT
CAAGAAACAAAGATTCAGCATGAGGAATTGAATAACAGAATTCAAACAACAGTAACAGAA
CTACAAAAAGTGAAAATGGAGAAAGAAGCTTTAATGACAGAGCTTTCTACAGTAAAGGAC
AAACTATCAAAAGTTTCTGATTCTTTGAAAAACTCTAAAAGTGAATTTGAAAAGGAGAAT
CAGAAAGGAAAAGCCGCTATATTAGACTTGGAAAAAACTTGCAAAGAATTAAAGCATCAA
CTTCAAGTGCAGATGGAAAACACACTTAAGGAACAGAAGGAACTGAAAAAGTCACTTGAA
AAAGAGAAGGAGGCTTCTCATCAGTTGAAATTGGAACTCAATTCAATGCAGGAACAACTT
ATACAGGCCCAGAATACTTTAAAACAAAATGAAAAAGAAGAGCAACAACTTCAGGGGAAC
ATAAATGAGCTAAAGCAATCAAGTGAACAGAAGAAAAAACAAATTGAAGCACTCCAAGGA
GAGCTTAAAATTGCTGTTTTACAGAAGACAGAGCTTGAGAATAAACTACAGCAGCAGTTA
ACACAGGCAGCCCAGGAACTTGCAGCAGAGAAAGAGAAAATATCAGTATTACAAAACAAC
TATGAAAAAAGTCAGGAAACTTTCAAACAGCTTCAATCTGATTTCTATGGGAGGGAATCT
GAACTTCTAGCCACCAGGCAAGATCTTAAGTCTGTAGAAGAGAAGCTTTCTCTAGCACAG
GAGGACTTGATTTCAAACAGAAATCAAATTGGAAATCAAAATAAATTGATTCAAGAACTG
AAGACTGCCAAGGCTACATTGGAGCAGGATTCAGCAAAGAAAGAACAGCAATTGCAGGAG
CGATGTAAAGCACTACAAGACATTCAGAAAGAAAAGTCACTGAAAGAAAAAGAACTGGTA
AATGAGAAGTCTAAATTGGCAGAGATAGAAGAAATTAAATGTAGACAAGAAAAAGAAATC
ACTAAACTAAACGAAGAACTCAAGTCCCACAAACTAGAAAGCATAAAGGAGATAACAAAT
CTTAAAGATGCTAAACAGCTTCTAATTCAGCAGAAATTAGAACTTCAAGGAAAAGCGGAC
TCCCTGAAGGCAGCTGTTGAACAGGAGAAGAGAAATCAGCAGATACTAAAAGACCAGGTG
AAAAAGGAAGAAGAGGAGCTGAAGAAAGAATTTATTGAGAAAGAAGCTAAGTTGCATTCC
GAAATAAAAGAAAAGGAAGTAGGAATGAAGAAGCATGAAGAAAATGAGGCTAAACTTACC
ATGCAGATTACAGCATTAAATGAAAACTTAGGCACTGTGAAGAAGGAGTGGCAATCTAGT
CAACGGAGAGTTAGTGAGCTTGAGAAACAAACGGATGACTTACGGGGTGAAATTGCAGTA
TTAGAAGCAACGGTTCAGAATAATCAAGATGAAAGGAGAGCACTACTGGAAAGATGTCTT
AAAGGAGAAGGTGAAATAGAAAAGCTTCAAACCAAAGTATTAGAATTGCAAAGAAAGCTG
GATAATACAACTGCAGTGCAGGAGCTGGGCAGAGAAAACCAATCACTTCAGATCAAACAT
ACACAAGCGTTGAATAGAAAGTGGGCCGAAGACAATGAAGTACAAAACTGTATGGCCTGT
GGGAAAGGCTTTTCAGTAACAGTGAGACGGCATCACTGCCGACAGTGTGGAAATATCTTC
TGTGCTGAATGTTCAGCCAAAAATGCCTTAACTCCTTCCTCCAAGAAGCCTGTTCGTGTC
TGTGATGCATGTTTCAATGACTTGCAAGGATAA
Protein Properties
Number of Residues 1411
Molecular Weight 162464.9
Theoretical pI 5.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Early endosome antigen 1
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSL
HRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
VSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
GenBank ID Protein 1016368
UniProtKB/Swiss-Prot ID Q15075
UniProtKB/Swiss-Prot Entry Name EEA1_HUMAN
PDB IDs
GenBank Gene ID L40157
GeneCard ID EEA1
GenAtlas ID EEA1
HGNC ID HGNC:3185
References
General References
  1. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  2. Mu FT, Callaghan JM, Steele-Mortimer O, Stenmark H, Parton RG, Campbell PL, McCluskey J, Yeo JP, Tock EP, Toh BH: EEA1, an early endosome-associated protein. EEA1 is a conserved alpha-helical peripheral membrane protein flanked by cysteine "fingers" and contains a calmodulin-binding IQ motif. J Biol Chem. 1995 Jun 2;270(22):13503-11. [PubMed:7768953 ]
  3. Simonsen A, Lippe R, Christoforidis S, Gaullier JM, Brech A, Callaghan J, Toh BH, Murphy C, Zerial M, Stenmark H: EEA1 links PI(3)K function to Rab5 regulation of endosome fusion. Nature. 1998 Jul 30;394(6692):494-8. [PubMed:9697774 ]
  4. Callaghan J, Nixon S, Bucci C, Toh BH, Stenmark H: Direct interaction of EEA1 with Rab5b. Eur J Biochem. 1999 Oct 1;265(1):361-6. [PubMed:10491193 ]
  5. Simonsen A, Gaullier JM, D'Arrigo A, Stenmark H: The Rab5 effector EEA1 interacts directly with syntaxin-6. J Biol Chem. 1999 Oct 8;274(41):28857-60. [PubMed:10506127 ]
  6. Kutateladze TG, Ogburn KD, Watson WT, de Beer T, Emr SD, Burd CG, Overduin M: Phosphatidylinositol 3-phosphate recognition by the FYVE domain. Mol Cell. 1999 Jun;3(6):805-11. [PubMed:10394369 ]
  7. Gaullier JM, Ronning E, Gillooly DJ, Stenmark H: Interaction of the EEA1 FYVE finger with phosphatidylinositol 3-phosphate and early endosomes. Role of conserved residues. J Biol Chem. 2000 Aug 11;275(32):24595-600. [PubMed:10807926 ]
  8. Kauppi M, Simonsen A, Bremnes B, Vieira A, Callaghan J, Stenmark H, Olkkonen VM: The small GTPase Rab22 interacts with EEA1 and controls endosomal membrane trafficking. J Cell Sci. 2002 Mar 1;115(Pt 5):899-911. [PubMed:11870209 ]
  9. Merithew E, Stone C, Eathiraj S, Lambright DG: Determinants of Rab5 interaction with the N terminus of early endosome antigen 1. J Biol Chem. 2003 Mar 7;278(10):8494-500. Epub 2002 Dec 19. [PubMed:12493736 ]
  10. Dumas JJ, Merithew E, Sudharshan E, Rajamani D, Hayes S, Lawe D, Corvera S, Lambright DG: Multivalent endosome targeting by homodimeric EEA1. Mol Cell. 2001 Nov;8(5):947-58. [PubMed:11741531 ]
  11. Kutateladze T, Overduin M: Structural mechanism of endosome docking by the FYVE domain. Science. 2001 Mar 2;291(5509):1793-6. [PubMed:11230696 ]