Hmdb loader

Showing Protein Galectin-1 (HMDBP02427)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP02427
Secondary Accession Numbers
  • 7921
Name Galectin-1
Synonyms
  1. 14 kDa lectin
  2. Beta-galactoside- binding lectin L-14-I
  3. Galaptin
  4. HBL
  5. HPL
  6. Lactose-binding lectin 1
  7. Lectin galactoside-binding soluble 1
  8. Putative MAPK-activating protein MP12
  9. S-Lac lectin 1
Gene Name LGALS1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function May regulate cell apoptosis and cell differentiation. Binds beta-galactoside. Binds CD45, CD3 and CD4. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:22
Locus 22q13.1
SNPs LGALS1
Gene Sequence 
>408 bp
ATGGCTTGTGGTCTGGTCGCCAGCAACCTGAATCTCAAACCTGGAGAGTGCCTTCGAGTG
CGAGGCGAGGTGGCTCCTGACGCTAAGAGCTTCGTGCTGAACCTGGGCAAAGACAGCAAC
AACCTGTGCCTGCACTTCAACCCTCGCTTCAACGCCCACGGCGACGCCAACACCATCGTG
TGCAACAGCAAGGACGGCGGGGCCTGGGGGACCGAGCAGCGGGAGGCTGTCTTTCCCTTC
CAGCCTGGAAGTGTTGCAGAGGTGTGCATCACCTTCGACCAGGCCAACCTGACCGTCAAG
CTGCCAGATGGATACGAATTCAAGTTCCCCAACCGCCTCAACCTGGAGGCCATCAACTAC
ATGGCAGCTGACGGTGACTTCAAGATCAAATGTGTGGCCTTTGACTGA
Protein Properties
Number of Residues 135
Molecular Weight 14716.0
Theoretical pI 5.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>Galectin-1
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
GenBank ID Protein 34343
UniProtKB/Swiss-Prot ID P09382
UniProtKB/Swiss-Prot Entry Name LEG1_HUMAN
PDB IDs
GenBank Gene ID X14829
GeneCard ID LGALS1
GenAtlas ID LGALS1
HGNC ID HGNC:6561
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Matsuda A, Suzuki Y, Honda G, Muramatsu S, Matsuzaki O, Nagano Y, Doi T, Shimotohno K, Harada T, Nishida E, Hayashi H, Sugano S: Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways. Oncogene. 2003 May 22;22(21):3307-18. [PubMed:12761501 ]
  4. Hirabayashi J, Ayaki H, Soma G, Kasai K: Cloning and nucleotide sequence of a full-length cDNA for human 14 kDa beta-galactoside-binding lectin. Biochim Biophys Acta. 1989 Jun 1;1008(1):85-91. [PubMed:2719964 ]
  5. Couraud PO, Casentini-Borocz D, Bringman TS, Griffith J, McGrogan M, Nedwin GE: Molecular cloning, characterization, and expression of a human 14-kDa lectin. J Biol Chem. 1989 Jan 15;264(2):1310-6. [PubMed:2910856 ]
  6. Abbott WM, Feizi T: Evidence that the 14 kDa soluble beta-galactoside-binding lectin in man is encoded by a single gene. Biochem J. 1989 Apr 1;259(1):291-4. [PubMed:2719646 ]
  7. Gitt MA, Barondes SH: Genomic sequence and organization of two members of a human lectin gene family. Biochemistry. 1991 Jan 8;30(1):82-9. [PubMed:1988031 ]
  8. Hirabayashi J, Kasai K: Complete amino acid sequence of a beta-galactoside-binding lectin from human placenta. J Biochem. 1988 Jul;104(1):1-4. [PubMed:3065332 ]
  9. Hirabayashi J, Kawasaki H, Suzuki K, Kasai K: Further characterization and structural studies on human placenta lectin. J Biochem. 1987 Apr;101(4):987-95. [PubMed:3611046 ]
  10. Sharma A, Chemelli R, Allen HJ: Human splenic galaptin: physicochemical characterization. Biochemistry. 1990 Jun 5;29(22):5309-14. [PubMed:2383549 ]
  11. Perillo NL, Pace KE, Seilhamer JJ, Baum LG: Apoptosis of T cells mediated by galectin-1. Nature. 1995 Dec 14;378(6558):736-9. [PubMed:7501023 ]
  12. Walzel H, Schulz U, Neels P, Brock J: Galectin-1, a natural ligand for the receptor-type protein tyrosine phosphatase CD45. Immunol Lett. 1999 Apr 15;67(3):193-202. [PubMed:10369126 ]
  13. Fouillit M, Joubert-Caron R, Poirier F, Bourin P, Monostori E, Levi-Strauss M, Raphael M, Bladier D, Caron M: Regulation of CD45-induced signaling by galectin-1 in Burkitt lymphoma B cells. Glycobiology. 2000 Apr;10(4):413-9. [PubMed:10764829 ]
  14. Tinari N, Kuwabara I, Huflejt ME, Shen PF, Iacobelli S, Liu FT: Glycoprotein 90K/MAC-2BP interacts with galectin-1 and mediates galectin-1-induced cell aggregation. Int J Cancer. 2001 Jan 15;91(2):167-72. [PubMed:11146440 ]