You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02428
Secondary Accession Numbers
  • 7922
Name 2',3'-cyclic-nucleotide 3'-phosphodiesterase
Synonyms
  1. CNP
  2. CNPase
Gene Name CNP
Protein Type Enzyme
Biological Properties
General Function Involved in 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Specific Function May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin (By similarity).
Pathways Not Available
Reactions
Nucleoside 2',3'-cyclic phosphate + Water → nucleoside 2'-phosphate details
GO Classification
Biological Process
adult locomotory behavior
response to toxin
axonogenesis
cyclic nucleotide catabolic process
microtubule cytoskeleton organization
RNA metabolic process
synaptic transmission
Cellular Component
cytoplasm
plasma membrane
perinuclear region of cytoplasm
melanosome
extracellular space
microtubule
Component
membrane
cell part
intracellular
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
cyclic-nucleotide phosphodiesterase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Molecular Function
RNA binding
2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Process
rna metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
nucleoside monophosphate metabolic process
cell killing
nucleoside monophosphate catabolic process
cyclic nucleotide catabolic process
Cellular Location
  1. Melanosome
  2. Membrane
Gene Properties
Chromosome Location 17
Locus 17q21
SNPs CNP
Gene Sequence
>1266 bp
ATGAACAGAGGCTTCTCCCGAAAAAGCCACACATTCCTGCCCAAGATCTTCTTCCGCAAG
ATGTCATCCTCAGGGGCCAAGGACAAGCCTGAGCTGCAGTTTCCCTTCCTTCAGGATGAG
GACACAGTGGCCACGCTGCTAGAGTGCAAGACGCTCTTCATCTTGCGCGGCCTGCCAGGA
AGCGGCAAGTCCACGCTGGCACGGGTCATCGTGGACAAGTACCGTGATGGCACCAAGATG
GTGTCGGCTGACGCTTACAAGATCACCCCCGGCGCTCGAGGAGCCTTCTCCGAGGAGTAC
AAGCGGCTCGATGAGGACCTGGCTGCCTACTGCCGCCGCCGGGACATCAGAATTCTTGTG
CTTGATGACACCAACCACGAACGGGAACGGCTGGAGCAGCTCTTTGAAATGGCCGACCAG
TACCAGTACCAGGTGGTGCTGGTGGAGCCCAAGACGGCGTGGCGGCTGGACTGTGCCCAG
CTCAAGGAGAAGAACCAGTGGCAGCTGTCGGCTGATGACCTGAAGAAGCTGAAGCCTGGG
CTGGAGAAGGACTTCCTGCCGCTCTACTTCGGCTGGTTCCTGACCAAGAAGAGCTCTGAG
ACCCTCCGCAAAGCCGGCCAGGTCTTCCTGGAAGAGCTGGGGAACCACAAGGCCTTCAAG
AAGGAGCTGCGACAATTCGTCCCTGGGGATGAGCCCAGGGAGAAGATGGACTTGGTCACC
TACTTTGGAAAGAGACCCCCAGGCGTGCTGCATTGCACAACCAAGTTTTGTGACTACGGG
AAGGCTCCCGGGGCAGAGGAGTACGCTCAACAAGATGTGTTAAAGAAATCTTACTCCAAG
GCCTTCACGCTGACCATCTCTGCCCTCTTTGTGACACCCAAGACGACTGGGGCCCGGGTG
GAGTTAAGCGAGCAGCAACTGCAGTTGTGGCCGAGTGATGTGGACAAGCTGTCACCCACT
GACAACCTGCCGCGGGGGAGCCGCGCCCACATCACCCTCGGCTGTGCAGCTGACGTAGAG
GCCGTGCAGACGGGCCTTGACCTCTTAGAGATTCTGCGGCAGGAGAAGGGGGGCAGCCGA
GGCGAGGAGGTGGGCGAGCTAAGCCGGGGCAAGCTCTATTCCTTGGGCAATGGGCGCTGG
ATGCTGACCCTGGCCAAGAACATGGAGGTCAGGGCCATCTTCACGGGGTACTACGGGAAA
GGCAAACCTGTGCCCACGCAAGGTAGCCGGAAGGGGGGCGCCTTGCAGTCCTGCACCATC
ATATGA
Protein Properties
Number of Residues 421
Molecular Weight 47578.22
Theoretical pI 9.068
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>2',3'-cyclic-nucleotide 3'-phosphodiesterase
MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPG
SGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILV
LDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPG
LEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVT
YFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARV
ELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSR
GEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI
I
GenBank ID Protein 94721261
UniProtKB/Swiss-Prot ID P09543
UniProtKB/Swiss-Prot Entry Name CN37_HUMAN
PDB IDs
GenBank Gene ID NM_033133.4
GeneCard ID CNP
GenAtlas ID CNP
HGNC ID HGNC:2158
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  5. Basrur V, Yang F, Kushimoto T, Higashimoto Y, Yasumoto K, Valencia J, Muller J, Vieira WD, Watabe H, Shabanowitz J, Hearing VJ, Hunt DF, Appella E: Proteomic analysis of early melanosomes: identification of novel melanosomal proteins. J Proteome Res. 2003 Jan-Feb;2(1):69-79. [PubMed:12643545 ]
  6. Thompson RJ: 2',3'-cyclic nucleotide-3'-phosphohydrolase and signal transduction in central nervous system myelin. Biochem Soc Trans. 1992 Aug;20(3):621-6. [PubMed:1385234 ]
  7. Kurihara T, Takahashi Y, Nishiyama A, Kumanishi T: cDNA cloning and amino acid sequence of human brain 2',3'-cyclic-nucleotide 3'-phosphodiesterase. Biochem Biophys Res Commun. 1988 Apr 29;152(2):837-42. [PubMed:2835044 ]
  8. Monoh K, Kurihara T, Takahashi Y, Ichikawa T, Kumanishi T, Hayashi S, Minoshima S, Shimizu N: Structure, expression and chromosomal localization of the gene encoding human 2',3'-cyclic-nucleotide 3'-phosphodiesterase. Gene. 1993 Jul 30;129(2):297-301. [PubMed:8392017 ]
  9. Douglas AJ, Fox MF, Abbott CM, Hinks LJ, Sharpe G, Povey S, Thompson RJ: Structure and chromosomal localization of the human 2',3'-cyclic nucleotide 3'-phosphodiesterase gene. Ann Hum Genet. 1992 Jul;56(Pt 3):243-54. [PubMed:1360194 ]
  10. Stricker R, Kalbacher H, Reiser G: The epitope recognized by a monoclonal antibody in the myelin-associated protein CNP. Biochem Biophys Res Commun. 1997 Aug 18;237(2):266-70. [PubMed:9268698 ]
  11. Sakamoto Y, Tanaka N, Ichimiya T, Kurihara T, Nakamura KT: Crystal structure of the catalytic fragment of human brain 2',3'-cyclic-nucleotide 3'-phosphodiesterase. J Mol Biol. 2005 Feb 25;346(3):789-800. Epub 2005 Jan 12. [PubMed:15713463 ]