You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02438
Secondary Accession Numbers
  • 7932
Name Pro-epidermal growth factor
Synonyms
  1. EGF
  2. Epidermal growth factor
  3. Urogastrone
Gene Name EGF
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q25
SNPs EGF
Gene Sequence
>3624 bp
ATGCTGCTCACTCTTATCATTCTGTTGCCAGTAGTTTCAAAATTTAGTTTTGTTAGTCTC
TCAGCACCGCAGCACTGGAGCTGTCCTGAAGGTACTCTCGCAGGAAATGGGAATTCTACT
TGTGTGGGTCCTGCACCCTTCTTAATTTTCTCCCATGGAAATAGTATCTTTAGGATTGAC
ACAGAAGGAACCAATTATGAGCAATTGGTGGTGGATGCTGGTGTCTCAGTGATCATGGAT
TTTCATTATAATGAGAAAAGAATCTATTGGGTGGATTTAGAAAGACAACTTTTGCAAAGA
GTTTTTCTGAATGGGTCAAGGCAAGAGAGAGTATGTAATATAGAGAAAAATGTTTCTGGA
ATGGCAATAAATTGGATAAATGAAGAAGTTATTTGGTCAAATCAACAGGAAGGAATCATT
ACAGTAACAGATATGAAAGGAAATAATTCCCACATTCTTTTAAGTGCTTTAAAATATCCT
GCAAATGTAGCAGTTGATCCAGTAGAAAGGTTTATATTTTGGTCTTCAGAGGTGGCTGGA
AGCCTTTATAGAGCAGATCTCGATGGTGTGGGAGTGAAGGCTCTGTTGGAGACATCAGAG
AAAATAACAGCTGTGTCATTGGATGTGCTTGATAAGCGGCTGTTTTGGATTCAGTACAAC
AGAGAAGGAAGCAATTCTCTTATTTGCTCCTGTGATTATGATGGAGGTTCTGTCCACATT
AGTAAACATCCAACACAGCATAATTTGTTTGCAATGTCCCTTTTTGGTGACCGTATCTTC
TATTCAACATGGAAAATGAAGACAATTTGGATAGCCAACAAACACACTGGAAAGGACATG
GTTAGAATTAACCTCCATTCATCATTTGTACCACTTGGTGAACTGAAAGTAGTGCATCCA
CTTGCACAACCCAAGGCAGAAGATGACACTTGGGAGCCTGAGCAGAAACTTTGCAAATTG
AGGAAAGGAAACTGCAGCAGCACTGTGTGTGGGCAAGACCTCCAGTCACACTTGTGCATG
TGTGCAGAGGGATACGCCCTAAGTCGAGACCGGAAGTACTGTGAAGATGTTAATGAATGT
GCTTTTTGGAATCATGGCTGTACTCTTGGGTGTAAAAACACCCCTGGATCCTATTACTGC
ACGTGCCCTGTAGGATTTGTTCTGCTTCCTGATGGGAAACGATGTCATCAACTTGTTTCC
TGTCCACGCAATGTGTCTGAATGCAGCCATGACTGTGTTCTGACATCAGAAGGTCCCTTA
TGTTTCTGTCCTGAAGGCTCAGTGCTTGAGAGAGATGGGAAAACATGTAGCGGTTGTTCC
TCACCCGATAATGGTGGATGTAGCCAGCTCTGCGTTCCTCTTAGCCCAGTATCCTGGGAA
TGTGATTGCTTTCCTGGGTATGACCTACAACTGGATGAAAAAAGCTGTGCAGCTTCAGGA
CCACAACCATTTTTGCTGTTTGCCAATTCTCAAGATATTCGACACATGCATTTTGATGGA
ACAGACTATGGAACTCTGCTCAGCCAGCAGATGGGAATGGTTTATGCCCTAGATCATGAC
CCTGTGGAAAATAAGATATACTTTGCCCATACAGCCCTGAAGTGGATAGAGAGAGCTAAT
ATGGATGGTTCCCAGCGAGAAAGGCTTATTGAGGAAGGAGTAGATGTGCCAGAAGGTCTT
GCTGTGGACTGGATTGGCCGTAGATTCTATTGGACAGACAGAGGGAAATCTCTGATTGGA
AGGAGTGATTTAAATGGGAAACGTTCCAAAATAATCACTAAGGAGAACATCTCTCAACCA
CGAGGAATTGCTGTTCATCCAATGGCCAAGAGATTATTCTGGACTGATACAGGGATTAAT
CCACGAATTGAAAGTTCTTCCCTCCAAGGCCTTGGCCGTCTGGTTATAGCCAGCTCTGAT
CTAATCTGGCCCAGTGGAATAACGATTGACTTCTTAACTGACAAGTTGTACTGGTGCGAT
GCCAAGCAGTCTGTGATTGAAATGGCCAATCTGGATGGTTCAAAACGCCGAAGACTTACC
CAGAATGATGTAGGTCACCCATTTGCTGTAGCAGTGTTTGAGGATTATGTGTGGTTCTCA
GATTGGGCTATGCCATCAGTAATAAGAGTAAACAAGAGGACTGGCAAAGATAGAGTACGT
CTCCAAGGCAGCATGCTGAAGCCCTCATCACTGGTTGTGGTTCATCCATTGGCAAAACCA
GGAGCAGATCCCTGCTTATATCAAAACGGAGGCTGTGAACATATTTGCAAAAAGAGGCTT
GGAACTGCTTGGTGTTCGTGTCGTGAAGGTTTTATGAAAGCCTCAGATGGGAAAACGTGT
CTGGCTCTGGATGGTCATCAGCTGTTGGCAGGTGGTGAAGTTGATCTAAAGAACCAAGTA
ACACCATTGGACATCTTGTCCAAGACTAGAGTGTCAGAAGATAACATTACAGAATCTCAA
CACATGCTAGTGGCTGAAATCATGGTGTCAGATCAAGATGACTGTGCTCCTGTGGGATGC
AGCATGTATGCTCGGTGTATTTCAGAGGGAGAGGATGCCACATGTCAGTGTTTGAAAGGA
TTTGCTGGGGATGGAAAACTATGTTCTGATATAGATGAATGTGAGATGGGTGTCCCAGTG
TGCCCCCCTGCCTCCTCCAAGTGCATCAACACCGAAGGTGGTTATGTCTGCCGGTGCTCA
GAAGGCTACCAAGGAGATGGGATTCACTGTCTTGATATTGATGAGTGCCAACTGGGGGTG
CACAGCTGTGGAGAGAATGCCAGCTGCACAAATACAGAGGGAGGCTATACCTGCATGTGT
GCTGGACGCCTGTCTGAACCAGGACTGATTTGCCCTGACTCTACTCCACCCCCTCACCTC
AGGGAAGATGACCACCACTATTCCGTAAGAAATAGTGACTCTGAATGTCCCCTGTCCCAC
GATGGGTACTGCCTCCATGATGGTGTGTGCATGTATATTGAAGCATTGGACAAGTATGCA
TGCAACTGTGTTGTTGGCTACATCGGGGAGCGATGTCAGTACCGAGACCTGAAGTGGTGG
GAACTGCGCCACGCTGGCCACGGGCAGCAGCAGAAGGTCATCGTGGTGGCTGTCTGCGTG
GTGGTGCTTGTCATGCTGCTCCTCCTGAGCCTGTGGGGGGCCCACTACTACAGGACTCAG
AAGCTGCTATCGAAAAACCCAAAGAATCCTTATGAGGAGTCGAGCAGAGATGTGAGGAGT
CGCAGGCCTGCTGACACTGAGGATGGGATGTCCTCTTGCCCTCAACCTTGGTTTGTGGTT
ATAAAAGAACACCAAGACCTCAAGAATGGGGGTCAACCAGTGGCTGGTGAGGATGGCCAG
GCAGCAGATGGGTCAATGCAACCAACTTCATGGAGGCAGGAGCCCCAGTTATGTGGAATG
GGCACAGAGCAAGGCTGCTGGATTCCAGTATCCAGTGATAAGGGCTCCTGTCCCCAGGTA
ATGGAGCGAAGCTTTCATATGCCCTCCTATGGGACACAGACCCTTGAAGGGGGTGTCGAG
AAGCCCCATTCTCTCCTATCAGCTAACCCATTATGGCAACAAAGGGCCCTGGACCCACCA
CACCAAATGGAGCTGACTCAGTGA
Protein Properties
Number of Residues 1207
Molecular Weight 133993.1
Theoretical pI 5.68
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 1033-1053
Protein Sequence
>Pro-epidermal growth factor
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
GenBank ID Protein 31121
UniProtKB/Swiss-Prot ID P01133
UniProtKB/Swiss-Prot Entry Name EGF_HUMAN
PDB IDs Not Available
GenBank Gene ID X04571
GeneCard ID EGF
GenAtlas ID EGF
HGNC ID HGNC:3229
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Groenestege WM, Thebault S, van der Wijst J, van den Berg D, Janssen R, Tejpar S, van den Heuvel LP, van Cutsem E, Hoenderop JG, Knoers NV, Bindels RJ: Impaired basolateral sorting of pro-EGF causes isolated recessive renal hypomagnesemia. J Clin Invest. 2007 Aug;117(8):2260-7. [PubMed:17671655 ]
  3. Bell GI, Fong NM, Stempien MM, Wormsted MA, Caput D, Ku LL, Urdea MS, Rall LB, Sanchez-Pescador R: Human epidermal growth factor precursor: cDNA sequence, expression in vitro and gene organization. Nucleic Acids Res. 1986 Nov 11;14(21):8427-46. [PubMed:3491360 ]
  4. Gregory H, Preston BM: The primary structure of human urogastrone. Int J Pept Protein Res. 1977;9(2):107-18. [PubMed:300079 ]
  5. Furuya M, Akashi S, Hirayama K: The primary structure of human EGF produced by genetic engineering, studied by high-performance tandem mass spectrometry. Biochem Biophys Res Commun. 1989 Sep 15;163(2):1100-6. [PubMed:2789514 ]
  6. Hommel U, Harvey TS, Driscoll PC, Campbell ID: Human epidermal growth factor. High resolution solution structure and comparison with human transforming growth factor alpha. J Mol Biol. 1992 Sep 5;227(1):271-82. [PubMed:1522591 ]