Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02456
Secondary Accession Numbers
  • 7950
Name Interleukin-5 precursor
Synonyms
  1. B cell differentiation factor I
  2. Eosinophil differentiation factor
  3. IL-5
  4. T-cell replacing factor
  5. TRF
Gene Name IL5
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Factor that induces terminal differentiation of late- developing B-cells to immunoglobulin secreting cells
Pathways
  • Fc Epsilon Receptor I Signaling in Mast Cells
Reactions Not Available
GO Classification
Component
extracellular region
Function
cytokine activity
hematopoietin/interferon-class (d200-domain) cytokine receptor binding
signal transducer activity
receptor binding
growth factor activity
interleukin-5 receptor binding
Process
response to biotic stimulus
defense response
response to stimulus
immune response
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs IL5
Gene Sequence
>405 bp
ATGAGGATGCTTCTGCATTTGAGTTTGCTAGCTCTTGGAGCTGCCTACGTGTATGCCATC
CCCACAGAAATTCCCACAAGTGCATTGGTGAAAGAGACCTTGGCACTGCTTTCTACTCAT
CGAACTCTGCTGATAGCCAATGAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCAC
CAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAACTGTGCAA
GGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGC
CAAAAAAAAAAGTGTGGAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAA
GAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGA
Protein Properties
Number of Residues 134
Molecular Weight 15238.0
Theoretical pI 8.23
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions Not Available
Protein Sequence
>Interleukin-5 precursor
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
GenBank ID Protein 33836
UniProtKB/Swiss-Prot ID P05113
UniProtKB/Swiss-Prot Entry Name IL5_HUMAN
PDB IDs
GenBank Gene ID X04688
GeneCard ID IL5
GenAtlas ID IL5
HGNC ID HGNC:6016
References
General References
  1. Azuma C, Tanabe T, Konishi M, Kinashi T, Noma T, Matsuda F, Yaoita Y, Takatsu K, Hammarstrom L, Smith CI, et al.: Cloning of cDNA for human T-cell replacing factor (interleukin-5) and comparison with the murine homologue. Nucleic Acids Res. 1986 Nov 25;14(22):9149-58. [PubMed:3024129 ]
  2. Tanabe T, Konishi M, Mizuta T, Noma T, Honjo T: Molecular cloning and structure of the human interleukin-5 gene. J Biol Chem. 1987 Dec 5;262(34):16580-4. [PubMed:2824500 ]
  3. Campbell HD, Tucker WQ, Hort Y, Martinson ME, Mayo G, Clutterbuck EJ, Sanderson CJ, Young IG: Molecular cloning, nucleotide sequence, and expression of the gene encoding human eosinophil differentiation factor (interleukin 5). Proc Natl Acad Sci U S A. 1987 Oct;84(19):6629-33. [PubMed:3498940 ]
  4. Yokota T, Coffman RL, Hagiwara H, Rennick DM, Takebe Y, Yokota K, Gemmell L, Shrader B, Yang G, Meyerson P, et al.: Isolation and characterization of lymphokine cDNA clones encoding mouse and human IgA-enhancing factor and eosinophil colony-stimulating factor activities: relationship to interleukin 5. Proc Natl Acad Sci U S A. 1987 Nov;84(21):7388-92. [PubMed:2823259 ]
  5. Minamitake Y, Kodama S, Katayama T, Adachi H, Tanaka S, Tsujimoto M: Structure of recombinant human interleukin 5 produced by Chinese hamster ovary cells. J Biochem. 1990 Feb;107(2):292-7. [PubMed:2361960 ]
  6. Proudfoot AE, Davies JG, Turcatti G, Wingfield PT: Human interleukin-5 expressed in Escherichia coli: assignment of the disulfide bridges of the purified unglycosylated protein. FEBS Lett. 1991 May 20;283(1):61-4. [PubMed:2037074 ]
  7. Milburn MV, Hassell AM, Lambert MH, Jordan SR, Proudfoot AE, Graber P, Wells TN: A novel dimer configuration revealed by the crystal structure at 2.4 A resolution of human interleukin-5. Nature. 1993 May 13;363(6425):172-6. [PubMed:8483502 ]