| Identification |
| HMDB Protein ID
| HMDBP02456 |
| Secondary Accession Numbers
| |
| Name
| Interleukin-5 precursor |
| Synonyms
|
- B cell differentiation factor I
- Eosinophil differentiation factor
- IL-5
- T-cell replacing factor
- TRF
|
| Gene Name
| IL5 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Factor that induces terminal differentiation of late- developing B-cells to immunoglobulin secreting cells |
| Pathways
|
- Fc Epsilon Receptor I Signaling in Mast Cells
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| Function |
| cytokine activity |
| hematopoietin/interferon-class (d200-domain) cytokine receptor binding |
| signal transducer activity |
| receptor binding |
| growth factor activity |
| interleukin-5 receptor binding |
| Process |
| response to biotic stimulus |
| defense response |
| response to stimulus |
| immune response |
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
| Chromosome Location
| Chromosome:5 |
| Locus
| 5q31.1 |
| SNPs
| IL5 |
| Gene Sequence
|
>405 bp
ATGAGGATGCTTCTGCATTTGAGTTTGCTAGCTCTTGGAGCTGCCTACGTGTATGCCATC
CCCACAGAAATTCCCACAAGTGCATTGGTGAAAGAGACCTTGGCACTGCTTTCTACTCAT
CGAACTCTGCTGATAGCCAATGAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCAC
CAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAACTGTGCAA
GGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGC
CAAAAAAAAAAGTGTGGAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAA
GAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGA
|
| Protein Properties |
| Number of Residues
| 134 |
| Molecular Weight
| 15238.0 |
| Theoretical pI
| 8.23 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Interleukin-5 precursor
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
|
| External Links |
| GenBank ID Protein
| 33836 |
| UniProtKB/Swiss-Prot ID
| P05113 |
| UniProtKB/Swiss-Prot Entry Name
| IL5_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| X04688 |
| GeneCard ID
| IL5 |
| GenAtlas ID
| IL5 |
| HGNC ID
| HGNC:6016 |
| References |
| General References
| - Azuma C, Tanabe T, Konishi M, Kinashi T, Noma T, Matsuda F, Yaoita Y, Takatsu K, Hammarstrom L, Smith CI, et al.: Cloning of cDNA for human T-cell replacing factor (interleukin-5) and comparison with the murine homologue. Nucleic Acids Res. 1986 Nov 25;14(22):9149-58. [PubMed:3024129 ]
- Tanabe T, Konishi M, Mizuta T, Noma T, Honjo T: Molecular cloning and structure of the human interleukin-5 gene. J Biol Chem. 1987 Dec 5;262(34):16580-4. [PubMed:2824500 ]
- Campbell HD, Tucker WQ, Hort Y, Martinson ME, Mayo G, Clutterbuck EJ, Sanderson CJ, Young IG: Molecular cloning, nucleotide sequence, and expression of the gene encoding human eosinophil differentiation factor (interleukin 5). Proc Natl Acad Sci U S A. 1987 Oct;84(19):6629-33. [PubMed:3498940 ]
- Yokota T, Coffman RL, Hagiwara H, Rennick DM, Takebe Y, Yokota K, Gemmell L, Shrader B, Yang G, Meyerson P, et al.: Isolation and characterization of lymphokine cDNA clones encoding mouse and human IgA-enhancing factor and eosinophil colony-stimulating factor activities: relationship to interleukin 5. Proc Natl Acad Sci U S A. 1987 Nov;84(21):7388-92. [PubMed:2823259 ]
- Minamitake Y, Kodama S, Katayama T, Adachi H, Tanaka S, Tsujimoto M: Structure of recombinant human interleukin 5 produced by Chinese hamster ovary cells. J Biochem. 1990 Feb;107(2):292-7. [PubMed:2361960 ]
- Proudfoot AE, Davies JG, Turcatti G, Wingfield PT: Human interleukin-5 expressed in Escherichia coli: assignment of the disulfide bridges of the purified unglycosylated protein. FEBS Lett. 1991 May 20;283(1):61-4. [PubMed:2037074 ]
- Milburn MV, Hassell AM, Lambert MH, Jordan SR, Proudfoot AE, Graber P, Wells TN: A novel dimer configuration revealed by the crystal structure at 2.4 A resolution of human interleukin-5. Nature. 1993 May 13;363(6425):172-6. [PubMed:8483502 ]
|