You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02464
Secondary Accession Numbers
  • 7959
Name 5-hydroxytryptamine receptor 1F
Synonyms
  1. 5-HT-1F
  2. 5-HT1F
  3. Serotonin receptor 1F
Gene Name HTR1F
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p12
SNPs HTR1F
Gene Sequence
>1101 bp
ATGGATTTCTTAAATTCATCTGATCAAAACTTGACCTCAGAGGAACTGTTAAACAGAATG
CCATCCAAAATTCTGGTGTCCCTCACTCTGTCTGGGCTGGCACTGATGACAACAACTATC
AACTCCCTTGTGATCGCTGCAATTATTGTGACCCGGAAGCTGCACCATCCAGCCAATTAT
TTAATTTGTTCCCTTGCAGTCACAGATTTTCTTGTGGCTGTCCTGGTGATGCCCTTCAGC
ATTGTGTATATTGTGAGAGAGAGCTGGATTATGGGGCAAGTGGTCTGTGACATTTGGCTG
AGTGTTGACATTACCTGCTGCACGTGCTCCATCTTGCATCTCTCAGCTATAGCTTTGGAT
CGGTATCGAGCAATCACAGATGCTGTTGAGTATGCCAGGAAAAGGACTCCAAAGCATGCT
GGCATTATGATTACAATAGTTTGGATTATATCTGTTTTTATCTCTATGCCTCCTCTATTC
TGGAGGCACCAAGGAACTAGCAGAGATGATGAATGCATCATCAAGCACGACCACATTGTT
TCCACCATTTACTCAACATTTGGAGCTTTCTACATCCCACTGGCATTGATTTTGATCCTT
TACTACAAAATATATAGAGCAGCAAAGACATTATACCACAAGAGACAAGCAAGTAGGATT
GCAAAGGAGGAGGTGAATGGCCAAGTCCTTTTGGAGAGTGGTGAGAAAAGCACTAAATCA
GTTTCCACATCCTATGTACTAGAAAAGTCTTTATCTGACCCATCAACAGACTTTGATAAA
ATTCATAGCACAGTGAGAAGTCTCAGGTCTGAATTCAAGCATGAGAAATCTTGGAGAAGG
CAAAAGATCTCAGGTACAAGAGAACGGAAAGCAGCCACTACCCTGGGATTAATCTTGGGT
GCATTTGTAATATGTTGGCTTCCTTTTTTTGTAAAAGAATTAGTTGTTAATGTCTGTGAC
AAATGTAAAATTTCTGAAGAAATGTCCAATTTTTTGGCATGGCTTGGGTATCTCAATTCC
CTTATAAATCCACTGATTTACACAATCTTTAATGAAGACTTCAAGAAAGCATTCCAAAAG
CTTGTGCGATGTCGATGTTAG
Protein Properties
Number of Residues 366
Molecular Weight 41708.5
Theoretical pI 9.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 30-50
  • 65-85
  • 98-118
  • 141-161
  • 179-199
  • 291-311
  • 330-350
Protein Sequence
>5-hydroxytryptamine receptor 1F
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
GenBank ID Protein 20379136
UniProtKB/Swiss-Prot ID P30939
UniProtKB/Swiss-Prot Entry Name 5HT1F_HUMAN
PDB IDs Not Available
GenBank Gene ID AF498981
GeneCard ID HTR1F
GenAtlas ID HTR1F
HGNC ID HGNC:5292
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Lovenberg TW, Erlander MG, Baron BM, Racke M, Slone AL, Siegel BW, Craft CM, Burns JE, Danielson PE, Sutcliffe JG: Molecular cloning and functional expression of 5-HT1E-like rat and human 5-hydroxytryptamine receptor genes. Proc Natl Acad Sci U S A. 1993 Mar 15;90(6):2184-8. [PubMed:8384716 ]
  3. Adham N, Kao HT, Schecter LE, Bard J, Olsen M, Urquhart D, Durkin M, Hartig PR, Weinshank RL, Branchek TA: Cloning of another human serotonin receptor (5-HT1F): a fifth 5-HT1 receptor subtype coupled to the inhibition of adenylate cyclase. Proc Natl Acad Sci U S A. 1993 Jan 15;90(2):408-12. [PubMed:8380639 ]