You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02486
Secondary Accession Numbers
  • 7981
  • HMDBP03519
Name Solute carrier family 12 member 5
Synonyms
  1. Electroneutral potassium-chloride cotransporter 2
  2. K-Cl cotransporter 2
  3. Neuronal K-Cl cotransporter
  4. hKCC2
Gene Name SLC12A5
Protein Type Transporter
Biological Properties
General Function Involved in transport
Specific Function Mediates electroneutral potassium-chloride cotransport in mature neurons. Transport occurs under isotonic conditions, but is activated 20-fold by cell swelling. Important for Cl(-) homeostasis in neurons
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
anion:cation symporter activity
cation:chloride symporter activity
Process
sodium ion transport
establishment of localization
transport
chloride transport
transmembrane transport
anion transport
inorganic anion transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.12
SNPs SLC12A5
Gene Sequence
>3420 bp
ATGAGCCGCAGGTTCACGGTCACCTCGCTGCCCCCCGCAGGGCCCGCCAGAAGCCCTGAC
CCAGAGTCCCGCCGGCATTCGGTCGCAGACCCCCGCCACCTCCCGGGGGAAGACGTCAAA
GGTGATGGCAACCCCAAGGAAAGCAGTCCCTTCATCAACAGCACCGACACAGAGAAGGGA
AAGGAGTATGATGGCAAGAACATGGCCTTGTTTGAGGAGGAGATGGACACCAGCCCTATG
GTGTCCTCCTTGCTCAGTGGCCTGGCCAACTACACCAACCTGCCCCAGGGAAGTAGGGAG
CATGAAGAGGCAGAAAACAATGAGGGTGGAAAAAAGAAGCCGGTGCAGGCCCCACGCATG
GGCACCTTCATGGGCGTGTACCTGCCGTGCCTGCAGAACATCTTTGGCGTCATCCTCTTC
CTGCGGCTCACCTGGGTGGTGGGCATTGCAGGCATCATGGAGTCCTTCTGCATGGTGTTC
ATCTGCTGCTCCTGTACGATGCTCACGGCCATCTCCATGAGTGCAATTGCAACGAATGGT
GTTGTGCCTGCTGGTGGCTCCTACTACATGATTTCCAGGTCTCTGGGCCCAGAGTTTGGG
GGTGCCGTGGGCCTCTGCTTCTACCTGGGCACTACCTTTGCAGGAGCCATGTACATCCTG
GGCACCATCGAAATCCTGCTGGCTTACCTCTTCCCAGCCATGGCCATCTTCAAGGCAGAA
GATGCCAGTGGGGAGGCAGCAGCCATGCTGAACAACATGCGTGTTTACGGCACCTGTGTG
CTCACCTGCATGGCCACTGTGGTGTTTGTGGGTGTCAAGTATGTCAACAAGTTTGCCCTT
GTCTTCCTGGGTTGTGTCATCCTCTCCATCCTGGCCATCTATGCTGGGGTCATCAAGTCT
GCCTTCGACCCACCCAACTTCCCGATCTGCCTCCTGGGTAACCGCACGCTGTCTCGCCAT
GGCTTTGATGTCTGTGCCAAGCTGGCTTGGGAAGGAAATGAGACGGTGACCACACGGCTA
TGGGGCCTTTTCTGCTCCTCTCGCTTCCTCAACGCCACCTGTGATGAATACTTCACCCGA
AACAATGTCACAGAGATCCAGGGCATCCCTGGTGCTGCCAGTGGCCTCATCAAAGAGAAC
CTCTGGAGCTCCTACCTGACCAAGGGCGTGATTGTGGAGAGGAGTGGGATGACCTCGGTG
GGCCTGGCCGATGGCACTCCTATCGACATGGACCACCCTTATGTCTTCAGTGATATGACC
TCCTACTTCACCCTGCTGGTTGGCATCTACTTCCCCTCAGTCACAGGGATCATGGCTGGT
TCTAACCGCTCTGGGGACCTGAGGGATGCCCAGAAGTCAATCCCCACTGGCACCATCCTG
GCCATCGCCACCACCTCTGCTGTCTACATCAGCTCCGTTGTTCTGTTTGGGGCCTGCATT
GAGGGGGTCGTCCTGCGGGACAAGTTTGGCGAAGCTGTGAATGGCAACCTCGTGGTGGGC
ACTCTGGCCTGGCCATCTCCATGGGTAATTGTCATCGGATCCTTCTTCTCCACCTGTGGG
GCTGGGCTGCAGAGCCTCACGGGGGCCCCACGCCTGCTGCAGGCCATCTCGAGGGATGGC
ATTGTGCCCTTCCTGCAGGTCTTTGGCCATGGCAAGGCCAATGGAGAGCCGACCTGGGCC
CTGCTCCTGACTGCCTGCATCTGCGAGATTGGCATCCTCATTGCATCCCTCGACGAGGTG
GCCCCCATCCTCTCTATGTTCTTCCTGATGTGCTACATGTTTGTGAATCTGGCCTGTGCA
GTGCAGACGCTGCTGAGGACACCCAACTGGAGGCCACGCTTTCGATATTACCACTGGACC
CTCTCCTTCCTGGGCATGAGCCTCTGCCTGGCCCTCATGTTCATCTGCTCCTGGTATTAT
GCACTGGTAGCCATGCTCATTGCTGGACTCATCTACAAGTACATTGAGTACCGTGGGGCA
GAGAAGGAGTGGGGCGATGGGATACGAGGTCTGTCTCTCAGTGCGGCTCGCTATGCCCTC
TTACGCCTGGAGGAAGGGCCCCCACACACCAAGAACTGGAGGCCACAGCTGCTGGTGCTG
GTGCGTGTGGACCAAGACCAGAATGTGGTGCACCCCCAGCTGCTCTCACTGACCTCCCAG
CTGAAGGCAGGGAAGGGCCTGACCATCGTGGGCTCTGTCCTTGAGGGCACCTTTCTGGAA
AATCATCCACAGGCCCAGCGGGCAGAAGAGTCTATCAGGCGCCTGATGGAGGCAGAGAAG
GTGAAGGGCTTCTGCCAGGTGGTGATCTCCTCCAACTTGCGTGATGGCGTGTCCCATCTG
ATCCAGTCCGGGGGCCTCGGGGGGCTGCAGCACAACACTGTGCTTGTTGGCTGGCCCCGC
AACTGGCGCCAGAAGGAAGATCATCAGACGTGGAGGAACTTCATTGAGCTGGTCCGGGAA
ACCACAGCTGGCCACTTAGCCCTGCTGGTCACCAAGAACGTTTCCATGTTTCCTGGGAAC
CCTGAGCGCTTCTCTGAGGGCAGCATCGACGTTTGGTGGATTGTGCACGATGGAGGCATG
CTCATGCTGCTGCCCTTCCTGCTGCGGCACCACAAGGTCTGGCGGAAGTGCAAGATGCGT
ATCTTCACTGTGGCCCAGATGGATGACAATAGCATCCAGATGAAGAAGGATCTGACCACA
TTTCTGTATCATTTACGCATCACTGCGGAGGTCGAGGTGGTGGAGATGCATGAGAGCGAC
ATCTCAGCTTACACCTATGAGAAGACGTTGGTGATGGAGCAGCGTTCCCAGATCCTCAAA
CAGATGCATTTAACCAAGAATGAGCGGGAGCGGGAGATCCAGAGTATCACAGATGAGTCA
CGAGGCTCAATCCGGAGAAAGAATCCAGCCAACACGCGGCTCCGCCTGAACGTCCCAGAA
GAGACGGCTGGTGACAGTGAAGAGAAGCCAGAGGAGGAGGTGCAGCTGATCCACGATCAG
AGTGCTCCCAGCTGCCCCAGCAGCTCCCCGTCCCCAGGGGAGGAGCCTGAGGGGGAAGGG
GAGACAGATCCGGAGAAGGTGCATCTCACCTGGACCAAGGACAAGTCGGTGGCAGAGAAG
AATAAGGGCCCCAGTCCTGTCTCCTCTGAGGGCATCAAGGACTTCTTCAGCATGAAGCCG
GAGTGGGAGAACTTGAACCAGTCCAACGTGCGGCGCATGCACACGGCCGTGCGGCTGAAC
GAGGTCATCGTGAAGAAATCCCGGGACGCCAAGCTTGTTTTGCTCAACATGCCTGGGCCT
CCCCGCAACCGCAATGGTGATGAAAACTACATGGAGTTTCTCGAGGTCCTCACAGAGCAC
CTGGACCGGGTGATGCTGGTCCGCGGCGGCGGCCGCGAGGTCATCACCATCTACTCCTGA
Protein Properties
Number of Residues 1139
Molecular Weight 126182.5
Theoretical pI 6.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 134-154
  • 156-176
  • 195-215
  • 217-237
  • 255-275
  • 278-298
  • 419-439
  • 459-479
  • 497-517
  • 570-590
  • 631-651
  • 848-868
Protein Sequence
>Solute carrier family 12 member 5
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFLNATCDEYFTR
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
ETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS
GenBank ID Protein 198041678
UniProtKB/Swiss-Prot ID Q9H2X9
UniProtKB/Swiss-Prot Entry Name S12A5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001134771.1
GeneCard ID SLC12A5
GenAtlas ID SLC12A5
HGNC ID HGNC:13818
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  5. Song L, Mercado A, Vazquez N, Xie Q, Desai R, George AL Jr, Gamba G, Mount DB: Molecular, functional, and genomic characterization of human KCC2, the neuronal K-Cl cotransporter. Brain Res Mol Brain Res. 2002 Jun 30;103(1-2):91-105. [PubMed:12106695 ]
  6. Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S: Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. Genome Res. 2006 Jan;16(1):55-65. Epub 2005 Dec 12. [PubMed:16344560 ]