You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02504
Secondary Accession Numbers
  • 7999
Name Putative G-protein coupled receptor 44
Synonyms
  1. CD294 antigen
  2. Chemoattractant receptor-homologous molecule expressed on Th2 cells
Gene Name GPR44
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Orphan receptor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
n-formyl peptide receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12-q13.3
SNPs GPR44
Gene Sequence
>1188 bp
ATGTCGGCCAACGCCACACTGAAGCCACTCTGCCCCATCCTGGAGCAGATGAGCCGTCTC
CAGAGCCACAGCAACACCAGCATCCGCTACATCGACCACGCGGCCGTGCTGCTGCACGGG
CTGGCCTCGCTGCTGGGCCTGGTGGAGAATGGAGTCATCCTCTTCGTGGTGGGCTGCCGC
ATGCGCCAGACCGTGGTCACCACCTGGGTGCTGCACCTGGCGCTGTCCGACCTGTTGGCC
TCTGCTTCCCTGCCCTTCTTCACCTACTTCTTGGCCGTGGGCCACTCGTGGGAGCTGGGC
ACCACCTTCTGCAAACTGCACTCCTCCATCTTCTTTCTCAACATGTTCGCCAGCGGCTTC
CTGCTCAGCGCCATCAGCCTGGACCGCTGCCTGCAGGTGGTGCGGCCGGTGTGGGCGCAG
AACCACCGCACCGTGGCCGCGGCGCACAAAGTCTGCCTGGTGCTTTGGGCACTAGCGGTG
CTCAACACGGTGCCCTATTTCGTGTTCCGGGACACCATCTCGCGGCTGGACGGGCGCATT
ATGTGCTACTACAATGTGCTGCTCCTGAACCCGGGGCCTGACCGCGATGCCACGTGCAAC
TCGCGCCAGGCGGCCCTGGCCGTCAGCAAGTTCCTGCTGGCCTTCCTGGTGCCGCTGGCG
ATCATCGCCTCGAGCCACGCGGCCGTGAGCCTGCGGTTGCAGCACCGCGGCCGCCGGCGG
CCAGGCCGCTTCGTGCGCCTGGTGGCAGCCGTCGTGGCCGCCTTCGCGCTCTGCTGGGGG
CCCTACCACGTGTTCAGCCTGCTGGAGGCGCGGGCGCACGCAAACCCGGGGCTGCGGCCG
CTCGTGTGGCGCGGGCTGCCCTTCGTCACCAGCCTGGCCTTCTTCAACAGCGTGGCCAAC
CCGGTGCTCTACGTGCTCACCTGCCCCGACATGCTGCGCAAGCTGCGGCGCTCGCTGCGC
ACGGTGCTGGAGAGCGTGCTGGTGGACGACAGCGAGCTGGGTGGCGCGGGAAGCAGCCGC
CGCCGCCGCACCTCCTCCACCGCCCGCTCGGCCTCCCCTTTAGCTCTCTGCAGCCGCCCG
GAGGAACCGCGGGGCCCCGCGCGTCTCCTCGGCTGGCTGCTGGGCAGCTGCGCAGCGTCC
CCGCAGACGGGCCCCCTGAACCGGGCGCTGAGCAGCACCTCGAGTTAG
Protein Properties
Number of Residues 395
Molecular Weight 43267.2
Theoretical pI 10.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 34-56
  • 68-89
  • 107-127
  • 147-168
  • 211-231
  • 248-269
  • 289-308
Protein Sequence
>Putative G-protein coupled receptor 44
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
GenBank ID Protein 4204216
UniProtKB/Swiss-Prot ID Q9Y5Y4
UniProtKB/Swiss-Prot Entry Name GPR44_HUMAN
PDB IDs Not Available
GenBank Gene ID AB008535
GeneCard ID GPR44
GenAtlas ID GPR44
HGNC ID HGNC:4502
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Marchese A, Sawzdargo M, Nguyen T, Cheng R, Heng HH, Nowak T, Im DS, Lynch KR, George SR, O'dowd BF: Discovery of three novel orphan G-protein-coupled receptors. Genomics. 1999 Feb 15;56(1):12-21. [PubMed:10036181 ]
  4. Nagata K, Tanaka K, Ogawa K, Kemmotsu K, Imai T, Yoshie O, Abe H, Tada K, Nakamura M, Sugamura K, Takano S: Selective expression of a novel surface molecule by human Th2 cells in vivo. J Immunol. 1999 Feb 1;162(3):1278-86. [PubMed:9973380 ]