Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02541
Secondary Accession Numbers
  • 8040
Name Low affinity sodium-glucose cotransporter
Synonyms
  1. Na(+)/glucose cotransporter 3
  2. Sodium/glucose cotransporter 3
  3. Solute carrier family 5 member 4
Gene Name SLC5A4
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Sodium-dependent glucose transporter (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
sodium ion transport
carbohydrate transport
Cellular Component
integral to membrane
Component
membrane
cell part
Function
transporter activity
Molecular Function
symporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 22
Locus 22q12.3
SNPs SLC5A4
Gene Sequence
>1980 bp
ATGGCCAGTACGGTTAGCCCCAGCACCATAGCTGAGACCCCAGAGCCACCTCCATTGTCT
GACCACATCCGAAATGCTGCTGACATCTCAGTCATTGTCATCTATTTTCTGGTGGTGATG
GCTGTTGGGCTGTGGGCGATGCTGAAGACCAACCGAGGTACTATAGGAGGCTTCTTCCTC
GCTGGTCGTGATATGGCCTGGTGGCCGATGGGCGCCTCTCTCTTTGCCAGTAACATCGGC
AGCAACCACTATGTGGGGCTGGCTGGGACAGGAGCAGCTTCAGGAGTCGCCACCGTAACA
TTTGAATGGACTTCCTCAGTAATGTTGCTGATTCTTGGGTGGATCTTTGTCCCTATCTAC
ATCAAGTCGGGGGTGATGACCATGCCGGAATATCTCAAGAAGCGGTTTGGTGGGGAGCGA
CTCCAGGTCTACCTCTCCATCCTCTCCCTCTTCATCTGTGTGGTTTTGTTAATTTCTGCA
GACATATTTGCTGGAGCCATATTCATCAAGCTGGCCTTGGGATTGGACCTTTACCTGGCA
ATCTTCATCCTCTTGGCTATGACTGCTGTTTACACCACCACTGGGGGCTTGGCCTCGGTG
ATTTACACAGACACCCTCCAGACCATCATCATGCTGATTGGCTCTTTTATTCTCATGGGG
TTTGCATTTAACGAAGTTGGAGGTTATGAGAGCTTTACCGAGAAGTACGTGAATGCCACC
CCATCCGTAGTCGAGGGGGACAACTTGACAATCAGTGCCAGTTGCTACACACCTCGGGCG
GACTCCTTCCATATCTTCCGAGATGCTGTGACTGGGGACATTCCATGGCCAGGAATTATA
TTTGGAATGCCCATTACAGCTTTGTGGTACTGGTGCACAAATCAGGTCATTGTGCAGCGC
TGCCTGTGTGGCAAGGACATGTCTCACGTGAAGGCCGCTTGCATTATGTGTGCTTACCTG
AAGCTGCTGCCCATGTTCCTCATGGTGATGCCGGGGATGATCAGCCGCATCCTGTACACA
GATATGGTAGCATGTGTGGTACCTTCTGAATGCGTGAAACACTGTGGCGTTGATGTTGGC
TGCACCAACTACGCATACCCCACGATGGTGCTGGAACTGATGCCCCAAGGACTGCGAGGC
CTGATGCTTTCGGTCATGCTGGCCTCTCTCATGAGCTCCCTGACCTCCATCTTCAACAGC
GCCAGCACCCTCTTCACCATTGACCTCTACACCAAGATGCGGAAGCAAGCGTCGGAGAAA
GAGCTCCTGATAGCTGGACGGATATTTGTTCTTCTATTAACTGTTGTGAGCATTGTGTGG
GTCCCACTGGTACAAGTTTCTCAAAATGGACAACTAATCCATTACACAGAATCAATTTCT
AGCTACCTTGGGCCTCCAATTGCAGCTGTCTTTGTGCTTGCCATCTTCTGTAAAAGAGTC
AATGAACAGGGAGCATTCTGGGGTCTAATGGTTGGACTTGCAATGGGCCTCATTCGTATG
ATAACAGAGTTTGCTTATGGAACAGGGAGTTGCTTGGCTCCCAGTAACTGTCCCAAGATT
ATCTGTGGAGTGCACTATCTGTACTTTTCCATCGTTCTCTTTTTTGGGTCCATGCTGGTC
ACCCTGGGAATTTCCCTCTTAACAAAACCCATTCCTGATGTACATCTGTACCGCCTGTGC
TGGGTTCTTCGGAACAGTACAGAGGAGCGAATCGATATAGATGCAGAAGAGAAAAGTCAG
GAAGAAACAGATGATGGTGTTGAAGAAGATTATCCTGAGAAATCACGTGGATGCCTCAAG
AAAGCTTATGACTTGTTCTGCGGTTTGCAGAAGGGACCCAAGCTAACCAAGGAGGAGGAG
GAAGCCTTGAGCAAGAAGCTCACAGACACGTCTGAGAGGCCCTCGTGGAGGACAATAGTG
AACATCAACGCCATCCTCCTCCTGGCTGTGGTGGTCTTTATTCACGGCTACTATGCCTGA
Protein Properties
Number of Residues 659
Molecular Weight 72454.78
Theoretical pI 6.154
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Low affinity sodium-glucose cotransporter
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
GenBank ID Protein 7263938
UniProtKB/Swiss-Prot ID Q9NY91
UniProtKB/Swiss-Prot Entry Name SC5A4_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ133127
GeneCard ID SLC5A4
GenAtlas ID SLC5A4
HGNC ID HGNC:11039
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]