Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02553
Secondary Accession Numbers
  • 8052
Name Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
Synonyms
  1. ATP-dependent dihydroxyacetone kinase
  2. DHA kinase
  3. FAD-AMP lyase (cyclic FMN forming)
  4. FAD-AMP lyase (cyclizing)
  5. FMN cyclase
  6. Glycerone kinase
Gene Name DAK
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate.
Pathways
  • Glycerolipid metabolism
  • RIG-I-like receptor signaling pathway
Reactions
Adenosine triphosphate + Dihydroxyacetone → ADP + Dihydroxyacetone phosphate details
Adenosine triphosphate + Glyceraldehyde → ADP + Glyceraldehyde 3-phosphate details
FAD → Adenosine monophosphate + riboflavin cyclic-4',5'-phosphate details
GO Classification
Biological Process
glycerol metabolic process
innate immune response
Cellular Component
cytosol
Function
glycerone kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Molecular Function
metal ion binding
ATP binding
FAD-AMP lyase (cyclizing) activity
glycerone kinase activity
triokinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q12.2
SNPs DAK
Gene Sequence
>1728 bp
ATGACCTCCAAGAAGCTGGCGAACTCGGTGGCTGGCTGTGCTGATGACGCTCTTGCTGGC
CTGGTGGCCTGCAACCCCAACCTGCAGCTCCTGCAGGGCCACCGCGTGGCCCTCCGTTCT
GACCTGGACAGCCTCAAGGGCCGGGTGGCACTGCTGTCGGGTGGGGGCTCTGGCCATGAG
CCTGCCCATGCTGGTTTCATAGGGAAGGGGATGCTGACTGGGGCCATCGCGGGAGCTGTG
TTCACCTCCCCGGCAGTGGGCAGCATCCTGGCAGCCATCAGGGCCGTGGCCCAGGCCGGC
ACAGTGGGGACGCTCCTTATCGTGAAGAACTACACTGGGGATCGGCTCAACTTCGGCCTG
GCCCGGGAGCAGGCCCGGGCTGAAGGCATCCCGGTGGAGATGGTGGTGATTGGGGACGAC
AGCGCCTTCACTGTCCTGAAGAAGGCAGGCCGGCGGGGGCTGTGCGGCACCGTGCTTATA
CACAAGGTGGCAGGTGCTCTGGCTGAGGCTGGTGTGGGGCTGGAGGAGATCGCAAAGCAG
GTGAACGTGGTCACCAAGGCCATGGGTACCCTGGGGGTGAGCTTATCCTCCTGCAGCGTC
CCTGGTTCCAAACCCACCTTCGAGCTCTCAGCCGACGAGGTGGAGCTGGGCCTGGGGATC
CACGGGGAAGCTGGTGTGCGCCGGATAAAGATGGCAACCGCCGATGAGATTGTGAAACTC
ATGCTCGACCACATGACAAACACCACCAACGCGTCCCATGTGCCTGTGCAGCCCGGCTCC
TCAGTTGTGATGATGGTCAACAACCTGGGTGGCCTGTCATTCCTGGAACTGGGCATCATA
GCCGACGCTACCGTCCGCTCCCTGGAGGGCCGCGGGGTGAAGATTGCCCGTGCCCTGGTG
GGCACCTTCATGTCAGCACTGGAGATGCCTGGCATTTCTCTCACCCTCCTGCTGGTGGAT
GAGCCTCTCCTGAAACTGATAGATGCTGAAACCACTGCAGCAGCCTGGCCTAACGTGGCT
GCAGTCTCCATTACTGGGCGGAAGCGGAGCCGGGTAGCCCCTGCCGAGCCCCAGGAGGCC
CCTGATTCCACTGCTGCAGGAGGCTCAGCCTCGAAGCGGATGGCGCCGGTGCTGGAACGG
GTGTGCAGCACTCTCCTGGGCCTGGAGGAACACCTGAATGCCCTGGACCGGGCTGCTGGT
GACGGCGACTGTGGCACCACCCACAGCCGTGCGGCCAGAGCAATCCAGGAGTGGCTGAAG
GAGGGCCCACCCCCTGCCAGCCCTGCCCAGCTGCTCTCCAAGTTGTCTGTTCTGCTCCTG
GAGAAGATGGGAGGCTCATCTGGGGCGCTCTATGGCCTGTTCCTGACTGCGGCTGCACAG
CCCCTGAAGGCCAAGACCAGCCTCCCAGCCTGGTCTGCTGCCATGGATGCCGGCCTGGAA
GCCATGCAGAAGTATGGCAAGGCTGCTCCAGGGGACAGGACTATGCTGGGTTCTCTGTGG
GCAGCGGGGCAGGAGCTCCAAGCCTGGAAGAGCCCAGGAGCTGATCTGTTACAAGTCCTG
ACCAAAGCAGTCAAGAGTGCCGAAGCTGCAGCCGAGGCCACCAAGAATATGGAAGCTGGA
GCCGGAAGAGCCAGTTATATCAGCTCAGCACGGCTGGAGCAGCCAGACCCCGGGGCGGTG
GCAGCTGCTGCCATCCTCCGGGCCATCTTGGAGGTCTTGCAGAGCTAG
Protein Properties
Number of Residues 575
Molecular Weight 58946.49
Theoretical pI 7.493
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQ
VNVVTKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL
MLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEA
PDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQS
GenBank ID Protein 10435998
UniProtKB/Swiss-Prot ID Q3LXA3
UniProtKB/Swiss-Prot Entry Name DHAK_HUMAN
PDB IDs Not Available
GenBank Gene ID AK023915
GeneCard ID DAK
GenAtlas ID Not Available
HGNC ID HGNC:24552
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cabezas A, Costas MJ, Pinto RM, Couto A, Cameselle JC: Identification of human and rat FAD-AMP lyase (cyclic FMN forming) as ATP-dependent dihydroxyacetone kinases. Biochem Biophys Res Commun. 2005 Dec 30;338(4):1682-9. Epub 2005 Nov 2. [PubMed:16289032 ]