Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02562
Secondary Accession Numbers
  • 8061
Name Recoverin
Synonyms
  1. Cancer-associated retinopathy protein
  2. Protein CAR
Gene Name RCVRN
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs RCVRN
Gene Sequence
>603 bp
ATGGGGAACAGCAAAAGTGGGGCCCTGTCCAAGGAGATCCTGGAGGAGCTGCAGCTGAAC
ACCAAGTTCTCGGAGGAGGAGCTGTGCTCCTGGTACCAGTCCTTCCTGAAGGACTGTCCC
ACCGGCCGCATCACCCAGCAGCAGTTCCAGAGCATCTACGCCAAGTTCTTCCCCGACACC
GACCCCAAGGCCTACGCCCAGCATGTGTTCCGCAGCTTCGATTCCAACCTCGACGGCACC
CTGGACTTCAAGGAGTACGTCATCGCCCTGCACATGACCACCGCGGGCAAGACCAACCAG
AAGCTGGAGTGGGCCTTCTCCCTCTACGACGTGGACGGTAACGGGACCATCAGCAAGAAT
GAAGTGCTGGAGATCGTCATGGCTATTTTCAAAATGATCACTCCCGAGGACGTGAAGCTC
CTTCCAGACGATGAAAACACGCCGGAAAAGCGAGCCGAGAAGATCTGGAAGTACTTTGGA
AAGAATGATGATGATAAACTTACAGAGAAAGAATTCATTGAGGGGACACTGGCCAATAAG
GAAATTCTGCGACTGATCCAGTTTGAGCCTCAAAAAGTGAAGGAAAAGATGAAGAACGCC
TGA
Protein Properties
Number of Residues 200
Molecular Weight 23130.1
Theoretical pI 4.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Recoverin
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
GenBank ID Protein 1902890
UniProtKB/Swiss-Prot ID P35243
UniProtKB/Swiss-Prot Entry Name RECO_HUMAN
PDB IDs
GenBank Gene ID AB001838
GeneCard ID RCVRN
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Murakami A, Yajima T, Inana G: Isolation of human retinal genes: recoverin cDNA and gene. Biochem Biophys Res Commun. 1992 Aug 31;187(1):234-44. [PubMed:1387789 ]
  3. Wiechmann AF, Hammarback JA: Molecular cloning and nucleotide sequence of a cDNA encoding recoverin from human retina. Exp Eye Res. 1993 Apr;56(4):463-70. [PubMed:8500558 ]
  4. Thirkill CE, Tait RC, Tyler NK, Roth AM, Keltner JL: The cancer-associated retinopathy antigen is a recoverin-like protein. Invest Ophthalmol Vis Sci. 1992 Sep;33(10):2768-72. [PubMed:1388144 ]
  5. Matsubara S, Yamaji Y, Sato M, Fujita J, Takahara J: Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines. Br J Cancer. 1996 Nov;74(9):1419-22. [PubMed:8912538 ]
  6. Polans AS, Buczylko J, Crabb J, Palczewski K: A photoreceptor calcium binding protein is recognized by autoantibodies obtained from patients with cancer-associated retinopathy. J Cell Biol. 1991 Mar;112(5):981-9. [PubMed:1999465 ]