Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02573
Secondary Accession Numbers
  • 8072
  • HMDBP04951
Name Carbonic anhydrase 3
Synonyms
  1. CA-III
  2. Carbonate dehydratase III
  3. Carbonic anhydrase III
Gene Name CA3
Protein Type Unknown
Biological Properties
General Function Involved in carbonate dehydratase activity
Specific Function Reversible hydration of carbon dioxide.
Pathways Not Available
Reactions
Hydrogen carbonate → CO(2) + Water details
Hydrogen carbonate → Carbon dioxide + Water details
GO Classification
Biological Process
small molecule metabolic process
response to oxidative stress
bicarbonate transport
one-carbon metabolic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
carbonate dehydratase activity
transition metal ion binding
zinc ion binding
lyase activity
carbon-oxygen lyase activity
hydro-lyase activity
Molecular Function
zinc ion binding
carbonate dehydratase activity
nickel cation binding
Process
metabolic process
cellular metabolic process
one-carbon metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 8
Locus 8q21.2
SNPs CA3
Gene Sequence
>783 bp
ATGGCCAAGGAGTGGGGCTACGCCAGTCACAACGGTCCTGACCACTGGCATGAACTTTTC
CCAAATGCCAAGGGGGAAAACCAGTCGCCCGTTGAGCTGCATACTAAAGACATCAGGCAT
GACCCTTCTCTGCAGCCATGGTCTGTGTCTTATGATGGTGGCTCTGCCAAGACCATCCTG
AATAATGGGAAGACCTGCCGAGTTGTATTTGATGATACTTATGATAGGTCAATGCTGAGA
GGGGGTCCTCTCCCTGGACCCTACCGACTTCGCCAGTTTCATCTTCACTGGGGCTCTTCG
GATGATCATGGCTCTGAGCACACCGTGGATGGAGTCAAGTATGCAGCGGAGCTTCATTTG
GTTCACTGGAACCCGAAGTATAACACTTTTAAAGAAGCCCTGAAGCAGCGCGATGGGATC
GCTGTGATTGGCATTTTTCTGAAGATAGGACATGAGAATGGCGAGTTCCAGATTTTCCTT
GATGCATTGGACAAGATTAAGACAAAGGGCAAGGAGGCGCCCTTCACAAAGTTTGACCCA
TCCTGCCTGTTCCCGGCATGCCGGGACTACTGGACCTACCAGGGCTCATTCACCACGCCG
CCCTGCGAGGAATGCATTGTGTGGCTGCTGCTGAAGGAGCCCATGACCGTGAGCTCTGAC
CAGATGGCCAAGCTGCGGAGCCTCCTCTCCAGTGCTGAGAACGAGCCCCCAGTGCCTCTT
GTGAGCAACTGGCGACCTCCACAGCCTATCAATAACAGGGTGGTGAGAGCTTCCTTCAAA
TGA
Protein Properties
Number of Residues 260
Molecular Weight 29557.215
Theoretical pI 7.338
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carbonic anhydrase 3
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
GenBank ID Protein 4885099
UniProtKB/Swiss-Prot ID P07451
UniProtKB/Swiss-Prot Entry Name CAH3_HUMAN
PDB IDs
GenBank Gene ID NM_005181.3
GeneCard ID CA3
GenAtlas ID CA3
HGNC ID HGNC:1374
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Crocetti L, Maresca A, Temperini C, Hall RA, Scozzafava A, Muhlschlegel FA, Supuran CT: A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases. Bioorg Med Chem Lett. 2009 Mar 1;19(5):1371-5. doi: 10.1016/j.bmcl.2009.01.038. Epub 2009 Jan 19. [PubMed:19186056 ]
  4. Maresca A, Temperini C, Vu H, Pham NB, Poulsen SA, Scozzafava A, Quinn RJ, Supuran CT: Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors. J Am Chem Soc. 2009 Mar 4;131(8):3057-62. doi: 10.1021/ja809683v. [PubMed:19206230 ]
  5. Di Fiore A, Monti SM, Hilvo M, Parkkila S, Romano V, Scaloni A, Pedone C, Scozzafava A, Supuran CT, De Simone G: Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide. Proteins. 2009 Jan;74(1):164-75. doi: 10.1002/prot.22144. [PubMed:18618712 ]
  6. Lloyd J, McMillan S, Hopkinson D, Edwards YH: Nucleotide sequence and derived amino acid sequence of a cDNA encoding human muscle carbonic anhydrase. Gene. 1986;41(2-3):233-9. [PubMed:3086182 ]
  7. Wade R, Gunning P, Eddy R, Shows T, Kedes L: Nucleotide sequence, tissue-specific expression, and chromosome location of human carbonic anhydrase III: the human CAIII gene is located on the same chromosome as the closely linked CAI and CAII genes. Proc Natl Acad Sci U S A. 1986 Dec;83(24):9571-5. [PubMed:3099285 ]
  8. Lloyd J, Brownson C, Tweedie S, Charlton J, Edwards YH: Human muscle carbonic anhydrase: gene structure and DNA methylation patterns in fetal and adult tissues. Genes Dev. 1987 Aug;1(6):594-602. [PubMed:2824285 ]
  9. Sowden J, Smith H, Morrison K, Edwards Y: Sequence comparisons and functional studies of the proximal promoter of the carbonic anhydrase 3 (CA3) gene. Gene. 1998 Jul 3;214(1-2):157-65. [PubMed:9651514 ]
  10. Duda DM, Tu C, Fisher SZ, An H, Yoshioka C, Govindasamy L, Laipis PJ, Agbandje-McKenna M, Silverman DN, McKenna R: Human carbonic anhydrase III: structural and kinetic study of catalysis and proton transfer. Biochemistry. 2005 Aug 2;44(30):10046-53. [PubMed:16042381 ]
  11. Elder I, Fisher Z, Laipis PJ, Tu C, McKenna R, Silverman DN: Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III. Proteins. 2007 Jul 1;68(1):337-43. [PubMed:17427958 ]