You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02584
Secondary Accession Numbers
  • 8083
Name Receptor-type tyrosine-protein phosphatase C
Synonyms
  1. CD45 antigen
  2. L-CA
  3. Leukocyte common antigen
  4. T200
Gene Name PTPRC
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Pathways
  • Cell adhesion molecules (CAMs)
  • Fc gamma R-mediated phagocytosis
  • Primary immunodeficiency
  • T cell receptor signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
B cell receptor signaling pathway
positive regulation of apoptotic process
positive regulation of protein kinase activity
negative regulation of protein autophosphorylation
response to gamma radiation
positive regulation of T cell proliferation
immunoglobulin biosynthetic process
regulation of B cell receptor signaling pathway
B cell differentiation
T cell receptor signaling pathway
release of sequestered calcium ion into cytosol
negative regulation of peptidyl-tyrosine phosphorylation
positive regulation of alpha-beta T cell proliferation
B cell proliferation
bone marrow development
hematopoietic progenitor cell differentiation
heterotypic cell-cell adhesion
negative regulation of cytokine-mediated signaling pathway
negative thymic T cell selection
positive regulation of antigen receptor-mediated signaling pathway
positive regulation of gamma-delta T cell differentiation
positive regulation of hematopoietic stem cell migration
positive regulation of humoral immune response mediated by circulating immunoglobulin
positive regulation of isotype switching to IgG isotypes
positive regulation of stem cell proliferation
defense response to virus
positive regulation of T cell mediated cytotoxicity
regulation of B cell differentiation
stem cell development
T cell differentiation
axon guidance
positive thymic T cell selection
positive regulation of B cell proliferation
negative regulation of cell adhesion involved in substrate-bound cell migration
negative regulation of T cell mediated cytotoxicity
T cell proliferation
leukocyte cell-cell adhesion
regulation of S phase
activation of MAPK activity
negative regulation of protein kinase activity
Cellular Component
membrane raft
focal adhesion
external side of plasma membrane
integral to plasma membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
transmembrane receptor protein tyrosine phosphatase activity
heparin binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
  3. Membrane raft
Gene Properties
Chromosome Location 1
Locus 1q31-q32
SNPs PTPRC
Gene Sequence
>3915 bp
ATGTATTTGTGGCTTAAACTCTTGGCATTTGGCTTTGCCTTTCTGGACACAGAAGTATTT
GTGACAGGGCAAAGCCCAACACCTTCCCCCACTGGATTGACTACAGCAAAGATGCCCAGT
GTTCCACTTTCAAGTGACCCCTTACCTACTCACACCACTGCATTCTCACCCGCAAGCACC
TTTGAAAGAGAAAATGACTTCTCAGAGACCACAACTTCTCTTAGTCCAGACAATACTTCC
ACCCAAGTATCCCCGGACTCTTTGGATAATGCTAGTGCTTTTAATACCACAGGTGTTTCA
TCAGTACAGACGCCTCACCTTCCCACGCACGCAGACTCGCAGACGCCCTCTGCTGGAACT
GACACGCAGACATTCAGCGGCTCCGCCGCCAATGCAAAACTCAACCCTACCCCAGGCAGC
AATGCTATCTCAGATGTCCCAGGAGAGAGGAGTACAGCCAGCACCTTTCCTACAGACCCA
GTTTCCCCATTGACAACCACCCTCAGCCTTGCACACCACAGCTCTGCTGCCTTACCTGCA
CGCACCTCCAACACCACCATCACAGCGAACACCTCAGATGCCTACCTTAATGCCTCTGAA
ACAACCACTCTGAGCCCTTCTGGAAGCGCTGTCATTTCAACCACAACAATAGCTACTACT
CCATCTAAGCCAACATGTGATGAAAAATATGCAAACATCACTGTGGATTACTTATATAAC
AAGGAAACTAAATTATTTACAGCAAAGCTAAATGTTAATGAGAATGTGGAATGTGGAAAC
AATACTTGCACAAACAATGAGGTGCATAACCTTACAGAATGTAAAAATGCGTCTGTTTCC
ATATCTCATAATTCATGTACTGCTCCTGATAAGACATTAATATTAGATGTGCCACCAGGG
GTTGAAAAGTTTCAGTTACATGATTGTACACAAGTTGAAAAAGCAGATACTACTATTTGT
TTAAAATGGAAAAATATTGAAACCTTTACTTGTGATACACAGAATATTACCTACAGATTT
CAGTGTGGTAATATGATATTTGATAATAAAGAAATTAAATTAGAAAACCTTGAACCCGAA
CATGAGTATAAGTGTGACTCAGAAATACTCTATAATAACCACAAGTTTACTAACGCAAGT
AAAATTATTAAAACAGATTTTGGGAGTCCAGGAGAGCCTCAGATTATTTTTTGTAGAAGT
GAAGCTGCACATCAAGGAGTAATTACCTGGAATCCCCCTCAAAGATCATTTCATAATTTT
ACCCTCTGTTATATAAAAGAGACAGAAAAAGATTGCCTCAATCTGGATAAAAACCTGATC
AAATATGATTTGCAAAATTTAAAACCTTATACGAAATATGTTTTATCATTACATGCCTAC
ATCATTGCAAAAGTGCAACGTAATGGAAGTGCTGCAATGTGTCATTTCACAACTAAAAGT
GCTCCTCCAAGCCAGGTCTGGAACATGACTGTCTCCATGACATCAGATAATAGTATGCAT
GTCAAGTGTAGGCCTCCCAGGGACCGTAATGGCCCCCATGAACGTTACCATTTGGAAGTT
GAAGCTGGAAATACTCTGGTTAGAAATGAGTCGCATAAGAATTGCGATTTCCGTGTAAAA
GATCTTCAATATTCAACAGACTACACTTTTAAGGCCTATTTTCACAATGGAGACTATCCT
GGAGAACCCTTTATTTTACATCATTCAACATCTTATAATTCTAAGGCACTGATAGCATTT
CTGGCATTTCTGATTATTGTGACATCAATAGCCCTGCTTGTTGTTCTCTACAAAATCTAT
GATCTACATAAGAAAAGATCCTGCAATTTAGATGAACAGCAGGAGCTTGTTGAAAGGGAT
GATGAAAAACAACTGATGAATGTGGAGCCAATCCATGCAGATATTTTGTTGGAAACTTAT
AAGAGGAAGATTGCTGATGAAGGAAGACTTTTTCTGGCTGAATTTCAGAGCATCCCGCGG
GTGTTCAGCAAGTTTCCTATAAAGGAAGCTCGAAAGCCCTTTAACCAGAATAAAAACCGT
TATGTTGACATTCTTCCTTATGATTATAACCGTGTTGAACTCTCTGAGATAAACGGAGAT
GCAGGGTCAAACTACATAAATGCCAGCTATATTGATGGTTTCAAAGAACCCAGGAAATAC
ATTGCTGCACAAGGTCCCAGGGATGAAACTGTTGATGATTTCTGGAGGATGATTTGGGAA
CAGAAAGCCACAGTTATTGTCATGGTCACTCGATGTGAAGAAGGAAACAGGAACAAGTGT
GCAGAATACTGGCCGTCAATGGAAGAGGGCACTCGGGCTTTTGGAGATGTTGTTGTAAAG
ATCAACCAGCACAAAAGATGTCCAGATTACATCATTCAGAAATTGAACATTGTAAATAAA
AAAGAAAAAGCAACTGGAAGAGAGGTGACTCACATTCAGTTCACCAGCTGGCCAGACCAC
GGGGTGCCTGAGGATCCTCACTTGCTCCTCAAACTGAGAAGGAGAGTGAATGCCTTCAGC
AATTTCTTCAGTGGTCCCATTGTGGTGCACTGCAGTGCTGGTGTTGGGCGCACAGGAACC
TATATCGGAATTGATGCCATGCTAGAAGGCCTGGAAGCCGAGAACAAAGTGGATGTTTAT
GGTTATGTTGTCAAGCTAAGGCGACAGAGATGCCTGATGGTTCAAGTAGAGGCCCAGTAC
ATCTTGATCCATCAGGCTTTGGTGGAATACAATCAGTTTGGAGAAACAGAAGTGAATTTG
TCTGAATTACATCCATATCTACATAACATGAAGAAAAGGGATCCACCCAGTGAGCCGTCT
CCACTAGAGGCTGAATTCCAGAGACTTCCTTCATATAGGAGCTGGAGGACACAGCACATT
GGAAATCAAGAAGAAAATAAAAGTAAAAACAGGAATTCTAATGTCATCCCATATGACTAT
AACAGAGTGCCACTTAAACATGAGCTGGAAATGAGTAAAGAGAGTGAGCATGATTCAGAT
GAATCCTCTGATGATGACAGTGATTCAGAGGAACCAAGCAAATACATCAATGCATCTTTT
ATAATGAGCTACTGGAAACCTGAAGTGATGATTGCTGCTCAGGGACCACTGAAGGAGACC
ATTGGTGACTTTTGGCAGATGATCTTCCAAAGAAAAGTCAAAGTTATTGTTATGCTGACA
GAACTGAAACATGGAGACCAGGAAATCTGTGCTCAGTACTGGGGAGAAGGAAAGCAAACA
TATGGAGATATTGAAGTTGACCTGAAAGACACAGACAAATCTTCAACTTATACCCTTCGT
GTCTTTGAACTGAGACATTCCAAGAGGAAAGACTCTCGAACTGTGTACCAGTACCAATAT
ACAAACTGGAGTGTGGAGCAGCTTCCTGCAGAACCCAAGGAATTAATCTCTATGATTCAG
GTCGTCAAACAAAAACTTCCCCAGAAGAATTCCTCTGAAGGGAACAAGCATCACAAGAGT
ACACCTCTACTCATTCACTGCAGGGATGGATCTCAGCAAACGGGAATATTTTGTGCTTTG
TTAAATCTCTTAGAAAGTGCGGAAACAGAAGAGGTAGTGGATATTTTTCAAGTGGTAAAA
GCTCTACGCAAAGCTAGGCCAGGCATGGTTTCCACATTCGAGCAATATCAATTCCTATAT
GACGTCATTGCCAGCACCTACCCTGCTCAGAATGGACAAGTAAAGAAAAACAACCATCAA
GAAGATAAAATTGAATTTGATAATGAAGTGGACAAAGTAAAGCAGGATGCTAATTGTGTT
AATCCACTTGGTGCCCCAGAAAAGCTCCCTGAAGCAAAGGAACAGGCTGAAGGTTCTGAA
CCCACGAGTGGCACTGAGGGGCCAGAACATTCTGTCAATGGTCCTGCAAGTCCAGCTTTA
AATCAAGGTTCATAG
Protein Properties
Number of Residues 1304
Molecular Weight 147485.375
Theoretical pI 6.155
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase C
MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPAST
FERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGT
DTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPA
RTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYN
KETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPG
VEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPE
HEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNF
TLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKS
APPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVK
DLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPR
VFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKY
IAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVK
INQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQY
ILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHI
GNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASF
IMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQT
YGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQ
VVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVK
ALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCV
NPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
GenBank ID Protein 18641347
UniProtKB/Swiss-Prot ID P08575
UniProtKB/Swiss-Prot Entry Name PTPRC_HUMAN
PDB IDs
GenBank Gene ID NM_002838.3
GeneCard ID PTPRC
GenAtlas ID PTPRC
HGNC ID HGNC:9666
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  7. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  8. Salgado FJ, Lojo J, Alonso-Lebrero JL, Lluis C, Franco R, Cordero OJ, Nogueira M: A role for interleukin-12 in the regulation of T cell plasma membrane compartmentation. J Biol Chem. 2003 Jul 4;278(27):24849-57. Epub 2003 Apr 3. [PubMed:12676959 ]
  9. Streuli M, Hall LR, Saga Y, Schlossman SF, Saito H: Differential usage of three exons generates at least five different mRNAs encoding human leukocyte common antigens. J Exp Med. 1987 Nov 1;166(5):1548-66. [PubMed:2824653 ]
  10. Ralph SJ, Thomas ML, Morton CC, Trowbridge IS: Structural variants of human T200 glycoprotein (leukocyte-common antigen). EMBO J. 1987 May;6(5):1251-7. [PubMed:2956090 ]
  11. Tsai AY, Streuli M, Saito H: Integrity of the exon 6 sequence is essential for tissue-specific alternative splicing of human leukocyte common antigen pre-mRNA. Mol Cell Biol. 1989 Oct;9(10):4550-5. [PubMed:2531281 ]
  12. Hall LR, Streuli M, Schlossman SF, Saito H: Complete exon-intron organization of the human leukocyte common antigen (CD45) gene. J Immunol. 1988 Oct 15;141(8):2781-7. [PubMed:2971730 ]
  13. Charbonneau H, Tonks NK, Walsh KA, Fischer EH: The leukocyte common antigen (CD45): a putative receptor-linked protein tyrosine phosphatase. Proc Natl Acad Sci U S A. 1988 Oct;85(19):7182-6. [PubMed:2845400 ]
  14. Streuli M, Krueger NX, Thai T, Tang M, Saito H: Distinct functional roles of the two intracellular phosphatase like domains of the receptor-linked protein tyrosine phosphatases LCA and LAR. EMBO J. 1990 Aug;9(8):2399-407. [PubMed:1695146 ]
  15. Wu L, Fu J, Shen SH: SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription. Mol Cell Biol. 2002 Apr;22(8):2673-86. [PubMed:11909961 ]
  16. Nam HJ, Poy F, Saito H, Frederick CA: Structural basis for the function and regulation of the receptor protein tyrosine phosphatase CD45. J Exp Med. 2005 Feb 7;201(3):441-52. Epub 2005 Jan 31. [PubMed:15684325 ]
  17. Jacobsen M, Schweer D, Ziegler A, Gaber R, Schock S, Schwinzer R, Wonigeit K, Lindert RB, Kantarci O, Schaefer-Klein J, Schipper HI, Oertel WH, Heidenreich F, Weinshenker BG, Sommer N, Hemmer B: A point mutation in PTPRC is associated with the development of multiple sclerosis. Nat Genet. 2000 Dec;26(4):495-9. [PubMed:11101853 ]
  18. Tchilian EZ, Wallace DL, Wells RS, Flower DR, Morgan G, Beverley PC: A deletion in the gene encoding the CD45 antigen in a patient with SCID. J Immunol. 2001 Jan 15;166(2):1308-13. [PubMed:11145714 ]