Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02594
Secondary Accession Numbers
  • 8093
Name Copper transport protein ATOX1
Synonyms
  1. Metal transport protein ATX1
Gene Name ATOX1
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
Pathways
  • Mineral absorption
Reactions Not Available
GO Classification
Biological Process
response to oxidative stress
cellular copper ion homeostasis
copper ion transport
Cellular Component
cytosol
Function
ion binding
cation binding
metal ion binding
binding
Molecular Function
copper chaperone activity
Process
establishment of localization
transport
ion transport
cation transport
metal ion transport
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q32
SNPs ATOX1
Gene Sequence
>207 bp
ATGCCGAAGCACGAGTTCTCTGTGGACATGACCTGTGGAGGCTGTGCTGAAGCTGTCTCT
CGGGTCCTCAATAAGCTTGGAGGAGTTAAGTATGACATTGACCTGCCCAACAAGAAGGTC
TGCATTGAATCTGAGCACAGCATGGACACTCTGCTTGCAACCCTGAAGAAAACAGGAAAG
ACTGTTTCCTACCTTGGCCTTGAGTAG
Protein Properties
Number of Residues 68
Molecular Weight 7401.575
Theoretical pI 7.239
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Copper transport protein ATOX1
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGK
TVSYLGLE
GenBank ID Protein 158259587
UniProtKB/Swiss-Prot ID O00244
UniProtKB/Swiss-Prot Entry Name ATOX1_HUMAN
PDB IDs
GenBank Gene ID AK293063
GeneCard ID ATOX1
GenAtlas ID ATOX1
HGNC ID HGNC:798
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Klomp LW, Lin SJ, Yuan DS, Klausner RD, Culotta VC, Gitlin JD: Identification and functional expression of HAH1, a novel human gene involved in copper homeostasis. J Biol Chem. 1997 Apr 4;272(14):9221-6. [PubMed:9083055 ]
  4. Liu PC, Koeller DM, Kaler SG: Genomic organization of ATOX1, a human copper chaperone. BMC Genet. 2003 Feb 5;4:4. [PubMed:12594858 ]
  5. Wernimont AK, Huffman DL, Lamb AL, O'Halloran TV, Rosenzweig AC: Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins. Nat Struct Biol. 2000 Sep;7(9):766-71. [PubMed:10966647 ]