Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02616
Secondary Accession Numbers
  • 8115
Name Solute carrier family 52, riboflavin transporter, member 1
Synonyms
  1. PERV-A receptor 2
  2. Porcine endogenous retrovirus A receptor 2
  3. Protein GPR172B
  4. hRFT1
  5. Riboflavin transporter 1
Gene Name SLC52A1
Protein Type Enzyme
Biological Properties
General Function Involved in receptor activity
Specific Function Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to plasma membrane
Molecular Function
riboflavin transporter activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 17
Locus 17p13.2
SNPs GPR172B
Gene Sequence
>1347 bp
ATGGCAGCACCCACGCTGGGCCGTCTGGTGCTGACCCACCTGCTGGTGGCCCTTTTTGGC
ATGGGCTCCTGGGCTGCTGTGAACGGGATCTGGGTGGAGCTGCCTGTGGTGGTAAAAGAC
CTTCCAGAGGGTTGGAGCCTCCCCTCATACCTCTCTGTGGTTGTGGCGCTGGGAAACCTG
GGTCTGCTGGTGGTGACCCTGTGGAGGCGGCTGGCCCCGGGCAAGGGCGAGCAGGTCCCC
ATCCAGGTGGTACAGGTGCTGAGTGTAGTGGGCACAGCCCTGCTGGCCCCTCTGTGGCAC
CACGTGGCCCCAGTGGCAGGGCAGCTCCACTCTGTGGCCTTCCTAACTCTGGCCTTGGTG
TTGGCAATGGCCTGTTGTACCTCTAATGTCACTTTCCTGCCCTTCCTGAGCCACCTGCCA
CCTCCTTTCTTACGGTCTTTCTTCCTGGGTCAGGGTCTCAGTGCCCTACTCCCCTGTGTG
CTGGCCCTAGTGCAAGGTGTGGGCCGCCTCGAGTGCCCACCAGCGCCCACCAATGGCACC
TCTGGGCCTCCCCTCGACTTCCCTGAGCGTTTTCCTGCCAGCACCTTCTTCTGGGCACTG
ACTGCCCTTCTGGTCACTTCAGCTGCCGCCTTCCGGGGTCTCCTGTTGCTGTTGCCATCA
CTACCCTCTGTAACCACAGGGGGCTCAGGGCCTGAACTTCAACTGGGATCCCCAGGAGCA
GAGGAGGAAGAGAAGGAGGAAGAAGAGGCTTTGCCATTGCAGGAGCCACCGAGCCAGGCA
GCAGGCACCATCCCTGGCCCAGACCCTGAGGTCCATCAGCTGTTCTCAGCCCATGGTGCC
TTCCTGCTGGGCCTGATGGCCTTCACCAGTGCCGTGACCAATGGCGTGCTGCCTTCTGTG
CAGAGCTTTTCCTGTTTGCCCTATGGGCGCCTGGCCTACCACCTGGCTGTGGTGCTGGGC
AGTGCCGCCAACCCCCTTGCCTGCTTCCTGGCCATGGGCGTGCTGTGCAGGTCCCTGGCA
GGGCTGGTTGGTCTTTCTCTGCTGGGCATGCTCTTTGGGGCCTACCTGATGGCACTGGCA
ATCCTGAGCCCCTGCCCACCCCTGGTGGGCACCACTGCAGGGGTGGTCCTTGTGGTGCTG
TCGTGGGTGCTGTGTCTGTGTGTGTTCTCATATGTGAAGGTGGCTGCAAGCTCCCTGCTG
CATGGTGGGGGTCGGCCGGCATTGCTGGCAGCTGGTGTGGCCATCCAAGTGGGCTCCCTG
CTTGGTGCCGGTGCCATGTTCCCTCCCACCAGCATCTACCACGTGTTTCAAAGCAGAAAG
GACTGTGTAGACCCCTGTGGCCCCTGA
Protein Properties
Number of Residues 448
Molecular Weight 46316.245
Theoretical pI 6.347
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Riboflavin transporter 1
MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNL
GLLVVTLWRQLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALV
LAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGT
SGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGA
EEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSV
QSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALA
ILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSL
LGAGAMFPPTSIYHVFQSRKDCVDPCGP
GenBank ID Protein 204022240
UniProtKB/Swiss-Prot ID Q9NWF4
UniProtKB/Swiss-Prot Entry Name RFT_HUMAN
PDB IDs Not Available
GenBank Gene ID AB362533
GeneCard ID GPR172B
GenAtlas ID GPR172B
HGNC ID HGNC:30225
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Ericsson TA, Takeuchi Y, Templin C, Quinn G, Farhadian SF, Wood JC, Oldmixon BA, Suling KM, Ishii JK, Kitagawa Y, Miyazawa T, Salomon DR, Weiss RA, Patience C: Identification of receptors for pig endogenous retrovirus. Proc Natl Acad Sci U S A. 2003 May 27;100(11):6759-64. Epub 2003 May 9. [PubMed:12740431 ]
  5. Yonezawa A, Masuda S, Katsura T, Inui K: Identification and functional characterization of a novel human and rat riboflavin transporter, RFT1. Am J Physiol Cell Physiol. 2008 Sep;295(3):C632-41. doi: 10.1152/ajpcell.00019.2008. Epub 2008 Jul 16. [PubMed:18632736 ]
  6. Yao Y, Yonezawa A, Yoshimatsu H, Masuda S, Katsura T, Inui K: Identification and comparative functional characterization of a new human riboflavin transporter hRFT3 expressed in the brain. J Nutr. 2010 Jul;140(7):1220-6. doi: 10.3945/jn.110.122911. Epub 2010 May 12. [PubMed:20463145 ]