You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02622
Secondary Accession Numbers
  • 8121
Name Short transient receptor potential channel 3
Synonyms
  1. TRP-3
  2. Transient receptor protein 3
  3. TrpC3
  4. hTrp-3
  5. hTrp3
Gene Name TRPC3
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5- triphosphate receptors (ITPR) with bound IP3. May also be activated by internal calcium store depletion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q27
SNPs TRPC3
Gene Sequence
>2547 bp
ATGGAGGGAAGCCCATCCCTGAGACGCATGACAGTGATGCGGGAGAAGGGCCGGCGCCAG
GCTGTCAGGGGCCCGGCCTTCATGTTCAATGACCGCGGCACCAGCCTCACCGCCGAGGAG
GAGCGCTTCCTCGACGCCGCCGAGTACGGCAACATCCCAGTGGTGCGCAAGATGCTGGAG
GAGTCCAAGACGCTGAACGTCAACTGCGTGGACTACATGGGCCAGAACGCGCTGCAGCTG
GCTGTGGGCAACGAGCACCTGGAGGTGACCGAGCTGCTGCTCAAGAAGGAGAACCTGGCG
CGCATTGGCGACGCCCTGCTGCTCGCCATCAGCAAGGGCTACGTGCGCATTGTAGAGGCC
ATCCTCAACCACCCTGGCTTCGCGGCCAGCAAGCGTCTCACTCTGAGCCCCTGTGAGCAG
GAGCTGCAGGACGACGACTTCTACGCTTACGATGAGGACGGCACGCGCTTCTCGCCGGAC
ATCACCCCCATCATCCTGGCGGCGCACTGCCAGAAATACGAAGTGGTGCACATGCTGCTG
ATGAAGGGTGCCAGGATCGAGCGGCCGCACGACTATTTCTGCAAGTGCGGGGACTGCATG
GAGAAGCAGAGGCACGACTCCTTCAGCCACTCACGCTCGAGGATCAATGCCTACAAGGGG
CTGGCCAGCCCGGCTTACCTCTCATTGTCCAGCGAGGACCCGGTGCTTACGGCCCTAGAG
CTCAGCAACGAGCTGGCCAAGCTGGCCAACATAGAGAAGGAGTTCAAGAATGACTATCGG
AAGCTCTCCATGCAATGCAAAGACTTTGTAGTGGGTGTGCTGGATCTCTGCCGAGACTCA
GAAGAGGTAGAAGCCATTCTGAATGGAGATCTGGAATCAGCAGAGCCTCTGGAGGTACAC
AGGCACAAAGCTTCATTAAGTCGTGTCAAACTTGCCATTAAGTATGAAGTCAAAAAGTTT
GTGGCTCATCCCAACTGCCAGCAGCAGCTCTTGACGATCTGGTATGAGAACCTCTCAGGC
CTAAGGGAGCAGACCATAGCTATCAAGTGTCTCGTTGTGCTGGTCGTGGCCCTGGGCCTT
CCATTCCTGGCCATTGGCTACTGGATCGCACCTTGCAGCAGGCTGGGGAAAATTCTGCGA
AGCCCTTTTATGAAGTTTGTAGCACATGCAGCTTCTTTCATCATCTTCCTGGGTCTGCTT
GTGTTCAATGCCTCAGACAGGTTCGAAGGCATCACCACGCTGCCCAATATCACAGTTACT
GACTATCCCAAACAGATCTTCAGGGTGAAAACCACCCAGTTTACATGGACTGAAATGCTA
ATTATGGTCTGGGTTCTTGGAATGATGTGGTCTGAATGTAAAGAGCTCTGGCTGGAAGGA
CCTAGGGAATACATTTTGCAGTTGTGGAATGTGCTTGACTTTGGGATGCTGTCCATCTTC
ATTGCTGCTTTCACAGCCAGATTCCTAGCTTTCCTTCAGGCAACGAAGGCACAACAGTAT
GTGGACAGTTACGTCCAAGAGAGTGACCTCAGTGAAGTGACACTCCCACCAGAGATACAG
TATTTCACTTATGCTAGAGATAAATGGCTCCCTTCTGACCCTCAGATTATATCTGAAGGC
CTTTATGCCATAGCTGTTGTGCTCAGCTTCTCTCGGATTGCGTACATCCTCCCTGCAAAT
GAGAGCTTTGGCCCCCTGCAGATCTCTCTTGGAAGGACTGTAAAGGACATATTCAAGTTC
ATGGTCCTCTTTATTATGGTGTTTTTTGCCTTTATGATTGGCATGTTCATACTTTATTCT
TACTACCTTGGGGCTAAAGTTAATGCTGCTTTTACCACTGTAGAAGAAAGTTTCAAGACT
TTATTTTGGTCAATATTTGGGTTGTCTGAAGTGACTTCCGTTGTGCTCAAATATGATCAC
AAATTCATAGAAAATATTGGATACGTTCTTTATGGAATATACAATGTAACTATGGTGGTC
GTTTTACTCAACATGCTAATTGCTATGATTAATAGCTCATATCAAGAAATTGAGGATGAC
AGTGATGTAGAATGGAAGTTTGCTCGTTCAAAACTTTGGTTATCCTATTTTGATGATGGA
AAAACATTACCTCCACCTTTCAGTCTAGTTCCTAGTCCAAAATCATTTGTTTATTTCATC
ATGCGAATTGTTAACTTTCCCAAATGCAGAAGGAGAAGACTTCAGAAGGATATAGAAATG
GGAATGGGTAACTCAAAGTCCAGGTTAAACCTCTTCACTCAGTCTAACTCAAGAGTTTTT
GAATCACACAGTTTTAACAGCATTCTCAATCAGCCAACACGTTATCAGCAGATAATGAAA
AGACTTATAAAGCGGTATGTCTTGAAAGCACAAGTAGACAAAGAAAATGATGAAGTTAAT
GAAGGTGAATTAAAAGAAATCAAGCAAGATATCTCCAGCCTTCGTTATGAACTTTTGGAA
GACAAGAGCCAAGCAACTGAGGAATTAGCCATTCTAATTCATAAACTTAGTGAGAAACTG
AATCCCAGCATGCTGAGATGTGAATGA
Protein Properties
Number of Residues 848
Molecular Weight 97354.1
Theoretical pI 6.74
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 350-370
  • 382-402
  • 431-451
  • 464-484
  • 536-556
  • 580-600
  • 616-636
  • 650-670
  • 707-726
Protein Sequence
>Short transient receptor potential channel 3
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLE
ESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEA
ILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLL
MKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALE
LSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVH
RHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGL
PFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVT
DYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIF
IAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEG
LYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYS
YYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVV
VLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFI
MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMK
RLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKL
NPSMLRCE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13507
UniProtKB/Swiss-Prot Entry Name TRPC3_HUMAN
PDB IDs Not Available
GenBank Gene ID U47050
GeneCard ID TRPC3
GenAtlas ID TRPC3
HGNC ID HGNC:12335
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhu X, Jiang M, Peyton M, Boulay G, Hurst R, Stefani E, Birnbaumer L: trp, a novel mammalian gene family essential for agonist-activated capacitative Ca2+ entry. Cell. 1996 May 31;85(5):661-71. [PubMed:8646775 ]
  3. Xu XZ, Li HS, Guggino WB, Montell C: Coassembly of TRP and TRPL produces a distinct store-operated conductance. Cell. 1997 Jun 27;89(7):1155-64. [PubMed:9215637 ]
  4. Wes PD, Chevesich J, Jeromin A, Rosenberg C, Stetten G, Montell C: TRPC1, a human homolog of a Drosophila store-operated channel. Proc Natl Acad Sci U S A. 1995 Oct 10;92(21):9652-6. [PubMed:7568191 ]
  5. Vannier B, Zhu X, Brown D, Birnbaumer L: The membrane topology of human transient receptor potential 3 as inferred from glycosylation-scanning mutagenesis and epitope immunocytochemistry. J Biol Chem. 1998 Apr 10;273(15):8675-9. [PubMed:9535843 ]
  6. Zhu X, Jiang M, Birnbaumer L: Receptor-activated Ca2+ influx via human Trp3 stably expressed in human embryonic kidney (HEK)293 cells. Evidence for a non-capacitative Ca2+ entry. J Biol Chem. 1998 Jan 2;273(1):133-42. [PubMed:9417057 ]
  7. Kiselyov K, Xu X, Mozhayeva G, Kuo T, Pessah I, Mignery G, Zhu X, Birnbaumer L, Muallem S: Functional interaction between InsP3 receptors and store-operated Htrp3 channels. Nature. 1998 Dec 3;396(6710):478-82. [PubMed:9853757 ]
  8. Hofmann T, Obukhov AG, Schaefer M, Harteneck C, Gudermann T, Schultz G: Direct activation of human TRPC6 and TRPC3 channels by diacylglycerol. Nature. 1999 Jan 21;397(6716):259-63. [PubMed:9930701 ]
  9. Boulay G, Brown DM, Qin N, Jiang M, Dietrich A, Zhu MX, Chen Z, Birnbaumer M, Mikoshiba K, Birnbaumer L: Modulation of Ca(2+) entry by polypeptides of the inositol 1,4, 5-trisphosphate receptor (IP3R) that bind transient receptor potential (TRP): evidence for roles of TRP and IP3R in store depletion-activated Ca(2+) entry. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):14955-60. [PubMed:10611319 ]
  10. Lussier MP, Cayouette S, Lepage PK, Bernier CL, Francoeur N, St-Hilaire M, Pinard M, Boulay G: MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC. J Biol Chem. 2005 May 13;280(19):19393-400. Epub 2005 Mar 9. [PubMed:15757897 ]
  11. Lussier MP, Lepage PK, Bousquet SM, Boulay G: RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC. Cell Calcium. 2008 May;43(5):432-43. Epub 2007 Sep 11. [PubMed:17850865 ]