Hmdb loader

Showing Protein Mannose-binding protein C (HMDBP02647)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP02647
Secondary Accession Numbers
  • 8147
Name Mannose-binding protein C
Synonyms
  1. Collectin-1
  2. MBP-C
  3. MBP1
  4. Mannan-binding protein
  5. Mannose-binding lectin
Gene Name MBL2
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11.2
SNPs MBL2
Gene Sequence 
>747 bp
ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCA
GAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCT
CCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGG
GAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGA
AATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGT
CCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCA
CGTATCAAAAAGTGGCTGACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTG
ACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCC
TCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAG
GAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGA
AATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAA
GATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCAT
CTGGCCGTCTGTGAGTTCCCTATCTGA
Protein Properties
Number of Residues 248
Molecular Weight 26143.3
Theoretical pI 5.14
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • None
Protein Sequence 
>Mannose-binding protein C
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
GenBank ID Protein 34487
UniProtKB/Swiss-Prot ID P11226
UniProtKB/Swiss-Prot Entry Name MBL2_HUMAN
PDB IDs
GenBank Gene ID X15422
GeneCard ID MBL2
GenAtlas ID MBL2
HGNC ID HGNC:6922
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ezekowitz RA, Day LE, Herman GA: A human mannose-binding protein is an acute-phase reactant that shares sequence homology with other vertebrate lectins. J Exp Med. 1988 Mar 1;167(3):1034-46. [PubMed:2450948 ]
  3. Sastry K, Herman GA, Day L, Deignan E, Bruns G, Morton CC, Ezekowitz RA: The human mannose-binding protein gene. Exon structure reveals its evolutionary relationship to a human pulmonary surfactant gene and localization to chromosome 10. J Exp Med. 1989 Oct 1;170(4):1175-89. [PubMed:2477486 ]
  4. Taylor ME, Brickell PM, Craig RK, Summerfield JA: Structure and evolutionary origin of the gene encoding a human serum mannose-binding protein. Biochem J. 1989 Sep 15;262(3):763-71. [PubMed:2590164 ]
  5. Madsen HO, Satz ML, Hogh B, Svejgaard A, Garred P: Different molecular events result in low protein levels of mannan-binding lectin in populations from southeast Africa and South America. J Immunol. 1998 Sep 15;161(6):3169-75. [PubMed:9743385 ]
  6. Juliger S, Kremsner PG, Alpers MP, Reeder JC, Kun JF: Restricted polymorphisms of the mannose-binding lectin gene in a population of Papua New Guinea. Mutat Res. 2002 Aug 29;505(1-2):87-91. [PubMed:12175909 ]
  7. Kurata H, Sannoh T, Kozutsumi Y, Yokota Y, Kawasaki T: Structure and function of mannan-binding proteins isolated from human liver and serum. J Biochem. 1994 Jun;115(6):1148-54. [PubMed:7982896 ]
  8. Thiel S, Vorup-Jensen T, Stover CM, Schwaeble W, Laursen SB, Poulsen K, Willis AC, Eggleton P, Hansen S, Holmskov U, Reid KB, Jensenius JC: A second serine protease associated with mannan-binding lectin that activates complement. Nature. 1997 Apr 3;386(6624):506-10. [PubMed:9087411 ]
  9. Nauta AJ, Raaschou-Jensen N, Roos A, Daha MR, Madsen HO, Borrias-Essers MC, Ryder LP, Koch C, Garred P: Mannose-binding lectin engagement with late apoptotic and necrotic cells. Eur J Immunol. 2003 Oct;33(10):2853-63. [PubMed:14515269 ]
  10. Palaniyar N, Nadesalingam J, Clark H, Shih MJ, Dodds AW, Reid KB: Nucleic acid is a novel ligand for innate, immune pattern recognition collectins surfactant proteins A and D and mannose-binding lectin. J Biol Chem. 2004 Jul 30;279(31):32728-36. Epub 2004 May 15. [PubMed:15145932 ]
  11. Hirano M, Ma BY, Kawasaki N, Okimura K, Baba M, Nakagawa T, Miwa K, Kawasaki N, Oka S, Kawasaki T: Mannan-binding protein blocks the activation of metalloproteases meprin alpha and beta. J Immunol. 2005 Sep 1;175(5):3177-85. [PubMed:16116208 ]
  12. Hummelshoj T, Fog LM, Madsen HO, Sim RB, Garred P: Comparative study of the human ficolins reveals unique features of Ficolin-3 (Hakata antigen). Mol Immunol. 2008 Mar;45(6):1623-32. Epub 2007 Nov 19. [PubMed:18006063 ]
  13. Sheriff S, Chang CY, Ezekowitz RA: Human mannose-binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil. Nat Struct Biol. 1994 Nov;1(11):789-94. [PubMed:7634089 ]
  14. Sumiya M, Super M, Tabona P, Levinsky RJ, Arai T, Turner MW, Summerfield JA: Molecular basis of opsonic defect in immunodeficient children. Lancet. 1991 Jun 29;337(8757):1569-70. [PubMed:1675710 ]
  15. Lipscombe RJ, Sumiya M, Hill AV, Lau YL, Levinsky RJ, Summerfield JA, Turner MW: High frequencies in African and non-African populations of independent mutations in the mannose binding protein gene. Hum Mol Genet. 1992 Dec;1(9):709-15. [PubMed:1304173 ]
  16. Super M, Gillies SD, Foley S, Sastry K, Schweinle JE, Silverman VJ, Ezekowitz RA: Distinct and overlapping functions of allelic forms of human mannose binding protein. Nat Genet. 1992 Sep;2(1):50-5. [PubMed:1303250 ]
  17. Gabolde M, Muralitharan S, Besmond C: Genotyping of the three major allelic variants of the human mannose-binding lectin gene by denaturing gradient gel electrophoresis. Hum Mutat. 1999;14(1):80-3. [PubMed:10447262 ]
  18. Thio CL, Mosbruger T, Astemborski J, Greer S, Kirk GD, O'Brien SJ, Thomas DL: Mannose binding lectin genotypes influence recovery from hepatitis B virus infection. J Virol. 2005 Jul;79(14):9192-6. [PubMed:15994813 ]