You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02713
Secondary Accession Numbers
  • 8216
Name 5-hydroxytryptamine receptor 6
Synonyms
  1. 5-HT-6
  2. 5-HT6
  3. Serotonin receptor 6
Gene Name HTR6
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs
Pathways
  • Excitatory Neural Signalling Through 5-HTR 6 and Serotonin
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36-p35
SNPs HTR6
Gene Sequence
>1323 bp
ATGGTCCCAGAGCCGGGCCCAACCGCCAATAGCACCCCGGCCTGGGGGGCAGGGCCGCCG
TCGGCCCCGGGGGGCAGCGGCTGGGTGGCGGCCGCGCTGTGCGTGGTCATCGCGCTGACG
GCGGCGGCCAACTCGCTGCTGATCGCGCTCATCTGCACTCAGCCCGCGCTGCGCAACACG
TCCAACTTCTTCCTGGTGTCGCTCTTCACGTCTGACCTGATGGTGGGGCTGGTGGTGATG
CCGCCGGCCATGCTGAACGCGCTGTACGGGCGCTGGGTGCTGGCGCGCGGCCTCTGCCTG
CTCTGGACCGCCTTCGACGTGATGTGCTGCAGCGCCTCCATCCTCAACCTCTGCCTCATC
AGCCTGGACCGCTACCTGCTCATCCTCTCGCCGCTGCGCTACAAGCTGCGCATGACGCCC
CTGCGTGCCCTGGCCCTAGTCCTGGGCGCCTGGAGCCTCGCCGCTCTCGCCTCCTTCCTG
CCCCTGCTGCTGGGCTGGCACGAGCTGGGCCACGCACGGCCACCCGTCCCTGGCCAGTGC
CGCCTGCTGGCCAGCCTGCCTTTTGTCCTTGTGGCGTCGGGCCTCACCTTCTTCCTGCCC
TCGGGTGCCATATGCTTCACCTACTGCAGGATCCTGCTAGCTGCCCGCAAGCAGGCCGTG
CAGGTGGCCTCCCTCACCACCGGCATGGCCAGTCAGGCCTCGGAGACGCTGCAGGTGCCC
AGGACCCCACGCCCAGGGGTGGAGTCTGCTGACAGCAGGCGTCTAGCCACGAAGCACAGC
AGGAAGGCCCTGAAGGCCAGCCTGACGCTGGGCATCCTGCTGGGCATGTTCTTTGTGACC
TGGTTGCCCTTCTTTGTGGCCAACATAGTCCAGGCCGTGTGCGACTGCATCTCCCCAGGC
CTCTTCGATGTCCTCACATGGCTGGGTTACTGTAACAGCACCATGAACCCCATCATCTAC
CCACTCTTCATGCGGGACTTCAAGCGGGCGCTGGGCAGGTTCCTGCCATGTCCACGCTGT
CCCCGGGAGCGCCAGGCCAGCCTGGCCTCGCCATCACTGCGCACCTCTCACAGCGGCCCC
CGGCCCGGCCTTAGCCTACAGCAGGTGCTGCCGCTGCCCCTGCCGCCGGACTCAGATTCG
GACTCAGACGCAGGCTCAGGCGGCTCCTCGGGCCTGCGGCTCACGGCCCAGCTGCTGCTT
CCTGGCGAGGCCACCCAGGACCCCCCGCTGCCCACCAGGGCCGCTGCCGCCGTCAATTTC
TTCAACATCGACCCCGCGGAGCCCGAGCTGCGGCCGCATCCACTTGGCATCCCCACGAAC
TGA
Protein Properties
Number of Residues 440
Molecular Weight 46953.6
Theoretical pI 9.02
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 35-57
  • 65-85
  • 101-122
  • 145-166
  • 185-208
  • 266-290
  • 296-320
Protein Sequence
>5-hydroxytryptamine receptor 6
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P50406
UniProtKB/Swiss-Prot Entry Name 5HT6R_HUMAN
PDB IDs Not Available
GenBank Gene ID L41147
GeneCard ID HTR6
GenAtlas ID HTR6
HGNC ID HGNC:5301
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R: Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry. Nat Methods. 2005 Aug;2(8):591-8. [PubMed:16094384 ]
  4. Ullmer C, Schmuck K, Kalkman HO, Lubbert H: Expression of serotonin receptor mRNAs in blood vessels. FEBS Lett. 1995 Aug 21;370(3):215-21. [PubMed:7656980 ]
  5. Kohen R, Metcalf MA, Khan N, Druck T, Huebner K, Lachowicz JE, Meltzer HY, Sibley DR, Roth BL, Hamblin MW: Cloning, characterization, and chromosomal localization of a human 5-HT6 serotonin receptor. J Neurochem. 1996 Jan;66(1):47-56. [PubMed:8522988 ]