Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02735
Secondary Accession Numbers
  • 8240
Name Xylulose kinase
Synonyms
  1. Xylulokinase
Gene Name XYLB
Protein Type Enzyme
Biological Properties
General Function Involved in phosphotransferase activity, alcohol group as acceptor
Specific Function Not Available
Pathways
  • Pentose and glucuronate interconversions
Reactions
Adenosine triphosphate + D-Xylulose → ADP + Xylulose 5-phosphate details
GO Classification
Biological Process
D-xylose metabolic process
generation of precursor metabolites and energy
xylulose catabolic process
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, alcohol group as acceptor
Molecular Function
ATP binding
xylulokinase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3p22-p21.3
SNPs XYLB
Gene Sequence
>1611 bp
ATGGCGGAGCACGCCCCTCGCCGCTGCTGCCTGGGCTGGGACTTCAGCACGCAGCAGGTA
AAGGTTGTTGCTGTTGATGCAGAGTTGAATGTCTTCTATGAGGAAAGTGTGCATTTTGAC
AGAGATCTTCCAGAATTTGGGACTCAGGGCGGTGTTCATGTGCACAAGGATGGGCTGACG
GTCACTTCTCCAGTACTAATGTGGGTCCAGGCACTGGATATCATCTTGGAGAAGATGAAG
GCTTCGGGCTTCGAATTCTCTCAAGTCCTAGCCTTGTCCGGGGCGGGCCAGCAACACGGA
AGTATATACTGGAAGGCTGGAGCCCAGCAGGCACTGACAAGCTTATCACCAGACCTCCGG
CTACACCAGCAGCTTCAGGACTGTTTCTCCATCAGCGACTGCCCGGTGTGGATGGACTCC
AGCACCACAGCCCAGTGCCGCCAGCTGGAGGCTGCTGTGGGTGGTGCTCAGGCTCTCAGC
TGCCTCACGGGGTCCCGTGCCTATGAGCGTTTTACAGGGAACCAAATTGCAAAAATTTAC
CAGCAGAACCCCGAGGCCTACTCACATACAGAGAGAATTTCTTTGGTCAGTAGCTTTGCT
GCTTCCCTGTTCCTTGGCTCTTACTCCCCTATTGACTACAGTGATGGTTCTGGAATGAAT
TTGTTGCAGATACAGGATAAAGTCTGGTCCCAGGCTTGCCTTGGTGCCTGTGCACCTCAT
TTAGAGGAGAAGCTTAGCCCACCAGTACCATCATGCTCAGTTGTGGGAGCCATTTCTTCC
TACTACGTCCAGCGCTACGGATTTCCTCCAGGATGCAAAGTGGTGGCCTTCACTGGGGAC
AACCCAGCGTCGCTGGCAGGCATGAGACTGGAGGAAGGTGACATTGCGGTCAGCCTGGGC
ACCAGTGACACCCTGTTTCTCTGGCTCCAAGAGCCCATGCCTGCCCTGGAAGGCCACATC
TTCTGCAACCCGGTTGACTCCCAGCACTACATGGCACTCCTGTGCTTTAAAAATGGCTCC
CTCATGAGAGAGAAGATCCGCAACGAGTCTGTATCCCGTTCCTGGAGCGATTTCTCTAAG
GCACTGCAGTCCACAGAGATGGGCAACGGTGGAAACCTGGGTTTTTATTTTGATGTAATG
GAGATCACCCCTGAAATTATTGGACGTCATAGGTTTAACACAGAAAACCACAAGGTTGCA
GCATTCCCTGGGGATGTGGAGGTTCGAGCACTAATTGAAGGACAATTCATGGCCAAGAGG
ATTCACGCAGAAGGCCTGGGCTATCGAGTCATGTCCAAGACAAAGATTTTGGCCACAGGA
GGAGCATCTCACAATAGAGAAATCTTACAGGTGCTTGCAGATGTGTTTGATGCCCCGGTG
TATGTTATAGACACTGCCAACTCGGCCTGTGTGGGTTCTGCATACCGAGCTTTTCATGGT
CTTGCAGGTGGAACAGATGTGCCCTTTTCAGAGGTTGTGAAGTTAGCTCCAAATCCCAGA
CTAGCTGCTACCCCAAGCCCGGGAGCTTCTCAGGTCTACGAGGCCCTTCTCCCCCAGTAT
GCCAAACTCGAGCAGAGAATCTTGTCTCAGACCCGGGGGCCTCCGGAGTGA
Protein Properties
Number of Residues 536
Molecular Weight 58381.695
Theoretical pI 5.861
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Xylulose kinase
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE
GenBank ID Protein 189067301
UniProtKB/Swiss-Prot ID O75191
UniProtKB/Swiss-Prot Entry Name XYLB_HUMAN
PDB IDs
GenBank Gene ID AK314386
GeneCard ID XYLB
GenAtlas ID XYLB
HGNC ID HGNC:12839
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  4. Tamari M, Daigo Y, Ishikawa S, Nakamura Y: Genomic structure of a novel human gene (XYLB) on chromosome 3p22-->p21.3 encoding a xylulokinase-like protein. Cytogenet Cell Genet. 1998;82(1-2):101-4. [PubMed:9763671 ]