You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02736
Secondary Accession Numbers
  • 8241
Name Keratinocyte growth factor
Synonyms
  1. FGF-7
  2. Fibroblast growth factor 7
  3. HBGF-7
  4. Heparin-binding growth factor 7
  5. KGF
Gene Name FGF7
Protein Type Enzyme
Biological Properties
General Function Involved in growth factor activity
Specific Function Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
receptor binding
growth factor activity
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 15q21.2
SNPs FGF7
Gene Sequence
>585 bp
ATGCACAAATGGATACTGACATGGATCCTGCCAACTTTGCTCTACAGATCATGCTTTCAC
ATTATCTGTCTAGTGGGTACTATATCTTTAGCTTGCAATGACATGACTCCAGAGCAAATG
GCTACAAATGTGAACTGTTCCAGCCCTGAGCGACACACAAGAAGTTATGATTACATGGAA
GGAGGGGATATAAGAGTGAGAAGACTCTTCTGTCGAACACAGTGGTACCTGAGGATCGAT
AAAAGAGGCAAAGTAAAAGGGACCCAAGAGATGAAGAATAATTACAATATCATGGAAATC
AGGACAGTGGCAGTTGGAATTGTGGCAATCAAAGGGGTGGAAAGTGAATTCTATCTTGCA
ATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCAATGAAGATTGTAACTTCAAA
GAACTAATTCTGGAAAACCATTACAACACATATGCATCAGCTAAATGGACACACAACGGA
GGGGAAATGTTTGTTGCCTTAAATCAAAAGGGGATTCCTGTAAGAGGAAAAAAAACGAAG
AAAGAACAAAAAACAGCCCACTTTCTTCCTATGGCAATAACTTAA
Protein Properties
Number of Residues 194
Molecular Weight 22509.1
Theoretical pI 9.51
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • None
Protein Sequence
>Keratinocyte growth factor
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
GenBank ID Protein 186739
UniProtKB/Swiss-Prot ID P21781
UniProtKB/Swiss-Prot Entry Name FGF7_HUMAN
PDB IDs
GenBank Gene ID M60828
GeneCard ID FGF7
GenAtlas ID FGF7
HGNC ID HGNC:3685
References
General References
  1. Finch PW, Rubin JS, Miki T, Ron D, Aaronson SA: Human KGF is FGF-related with properties of a paracrine effector of epithelial cell growth. Science. 1989 Aug 18;245(4919):752-5. [PubMed:2475908 ]
  2. Aaronson SA, Bottaro DP, Miki T, Ron D, Finch PW, Fleming TP, Ahn J, Taylor WG, Rubin JS: Keratinocyte growth factor. A fibroblast growth factor family member with unusual target cell specificity. Ann N Y Acad Sci. 1991;638:62-77. [PubMed:1664700 ]
  3. Rubin JS, Osada H, Finch PW, Taylor WG, Rudikoff S, Aaronson SA: Purification and characterization of a newly identified growth factor specific for epithelial cells. Proc Natl Acad Sci U S A. 1989 Feb;86(3):802-6. [PubMed:2915979 ]
  4. Beer HD, Bittner M, Niklaus G, Munding C, Max N, Goppelt A, Werner S: The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair. Oncogene. 2005 Aug 11;24(34):5269-77. [PubMed:15806171 ]