You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02737
Secondary Accession Numbers
  • 8242
Name Cryptochrome-1
Synonyms Not Available
Gene Name CRY1
Protein Type Unknown
Biological Properties
General Function Involved in DNA photolyase activity
Specific Function Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
dna photolyase activity
lyase activity
carbon-carbon lyase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna repair
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 12q23-q24.1
SNPs CRY1
Gene Sequence
>1761 bp
ATGGGGGTGAACGCCGTGCACTGGTTCCGAAAGGGGCTCCGGCTCCACGACAACCCCGCC
CTGAAGGAGTGCATTCAGGGCGCCGACACCATCCGCTGCGTCTACATCCTGGACCCCTGG
TTCGCCGGCTCCTCCAATGTGGGCATCAACAGGTGGCGATTTTTGCTTCAGTGTCTTGAG
GATCTTGATGCCAATCTACGAAAATTAAACTCCCGTCTGTTTGTGATTCGTGGACAACCA
GCAGATGTGTTTCCCAGGCTTTTCAAGGAATGGAACATTACTAAACTTTCAATTGAGTAT
GATTCTGAGCCCTTTGGAAAGGAACGAGACGCAGCTATTAAGAAACTGGCAACTGAAGCT
GGAGTAGAAGTCATTGTAAGAATTTCACATACATTATATGACCTAGACAAGATCATAGAA
CTCAATGGTGGACAACCGCCTCTAACTTATAAAAGATTCCAGACTCTCATCAGCAAAATG
GAACCACTAGAGATACCAGTAGAGACAATTACTTCAGAAGTGATAGAAAAGTGCACAACT
CCTCTGTCTGATGACCATGATGAGAAATATGGAGTCCCTTCACTGGAAGAGCTAGGTTTT
GATACAGATGGCTTATCCTCTGCAGTGTGGCCAGGCGGAGAAACTGAAGCACTTACTCGT
TTGGAAAGGCATTTGGAAAGAAAAGCTTGGGTGGCAAATTTTGAAAGACCTCGAATGAAT
GCGAATTCTCTGCTTGCAAGCCCTACTGGACTTAGTCCTTATCTCCGATTTGGTTGTTTG
TCATGTCGACTGTTTTACTTCAAACTAACAGATCTCTACAAAAAGGTAAAGAAGAACAGT
TCCCCTCCCCTTTCCCTTTATGGGCAACTGTTATGGCGTGAATTTTTCTATACAGCAGCA
ACAAATAATCCACGCTTTGATAAAATGGAAGGAAACCCTATCTGTGTTCAGATTCCTTGG
GATAAAAATCCTGAGGCTTTAGCCAAATGGGCGGAAGGCCGGACAGGCTTTCCATGGATT
GATGCCATCATGACACAGCTTCGTCAGGAGGGTTGGATTCATCATCTAGCCAGGCATGCA
GTTGCTTGCTTCCTGACACGAGGGGACCTGTGGATTAGTTGGGAAGAAGGAATGAAGGTA
TTTGAAGAATTATTGCTTGATGCAGATTGGAGCATAAATGCTGGAAGTTGGATGTGGCTG
TCTTGTAGTTCCTTTTTTCAACAGTTTTTTCACTGCTATTGCCCTGTTGGTTTTGGTAGG
AGAACAGATCCCAATGGAGACTATATCAGGCGTTATTTGCCTGTCCTAAGAGGCTTCCCT
GCAAAATATATCTATGATCCCTGGAATGCACCAGAAGGTATCCAAAAGGTAGCCAAATGT
TTGATAGGAGTTAATTATCCTAAACCAATGGTGAACCATGCTGAGGCAAGCCGTTTGAAT
ATCGAAAGGATGAAACAGATCTATCAGCAGCTTTCACGATATAGAGGACTAGGTCTTCTG
GCATCAGTACCTTCTAATCCTAATGGGAATGGAGGCTTCATGGGATATTCTGCAGAAAAT
ATCCCAGGTTGTAGCAGCAGTGGAAGTTGCTCTCAAGGGAGTGGTATTTTACACTATGCT
CATGGCGACAGTCAGCAAACTCACCTGTTGAAGCAAGGAAGAAGCTCCATGGGCACTGGT
CTCAGTGGTGGGAAACGTCCTAGTCAGGAAGAGGACACACAGAGTATTGGTCCTAAAGTC
CAGAGACAGAGCACTAATTAG
Protein Properties
Number of Residues 586
Molecular Weight 66394.2
Theoretical pI 8.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cryptochrome-1
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYA
HGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
GenBank ID Protein 22539647
UniProtKB/Swiss-Prot ID Q16526
UniProtKB/Swiss-Prot Entry Name CRY1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC030519
GeneCard ID CRY1
GenAtlas ID CRY1
HGNC ID HGNC:2384
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  3. Hsu DS, Zhao X, Zhao S, Kazantsev A, Wang RP, Todo T, Wei YF, Sancar A: Putative human blue-light photoreceptors hCRY1 and hCRY2 are flavoproteins. Biochemistry. 1996 Nov 5;35(44):13871-7. [PubMed:8909283 ]
  4. van der Spek PJ, Kobayashi K, Bootsma D, Takao M, Eker AP, Yasui A: Cloning, tissue expression, and mapping of a human photolyase homolog with similarity to plant blue-light receptors. Genomics. 1996 Oct 15;37(2):177-82. [PubMed:8921389 ]
  5. Todo T, Ryo H, Yamamoto K, Toh H, Inui T, Ayaki H, Nomura T, Ikenaga M: Similarity among the Drosophila (6-4)photolyase, a human photolyase homolog, and the DNA photolyase-blue-light photoreceptor family. Science. 1996 Apr 5;272(5258):109-12. [PubMed:8600518 ]
  6. Griffin EA Jr, Staknis D, Weitz CJ: Light-independent role of CRY1 and CRY2 in the mammalian circadian clock. Science. 1999 Oct 22;286(5440):768-71. [PubMed:10531061 ]
  7. Busino L, Bassermann F, Maiolica A, Lee C, Nolan PM, Godinho SI, Draetta GF, Pagano M: SCFFbxl3 controls the oscillation of the circadian clock by directing the degradation of cryptochrome proteins. Science. 2007 May 11;316(5826):900-4. Epub 2007 Apr 26. [PubMed:17463251 ]