You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02779
Secondary Accession Numbers
  • 8285
Name Ceramide synthase 1
Synonyms
  1. Longevity assurance gene 1 protein homolog 1
  2. Protein UOG-1
  3. CerS1
  4. LAG1 longevity assurance homolog 1
Gene Name CERS1
Protein Type Enzyme
Biological Properties
General Function Involved in sphingosine N-acyltransferase activity
Specific Function May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner (By similarity).
Pathways
  • sphingolipid metabolism
Reactions
Acyl-CoA + Sphingosine → Coenzyme A + N-Acylsphingosine details
Acyl-CoA + Sphinganine → Coenzyme A + Dihydroceramide details
GO Classification
Biological Process
small molecule metabolic process
ceramide biosynthetic process
phospholipid metabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Golgi membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Molecular Function
sphingosine N-acyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Isoform 1:Endoplasmic reticulum membrane
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs LASS1
Gene Sequence
>1053 bp
ATGGCGGCGGCGGGGCCCGCGGCGGGGCCGACGGGGCCCGAGCCCATGCCGAGCTACGCG
CAGCTAGTGCAGCGCGGCTGGGGCAGCGCGCTGGCGGCGGCGCGGGGCTGCACGGACTGC
GGCTGGGGGCTGGCGCGTCGCGGCCTGGCTGAGCACGCGCACCTGGCGCCGCCCGAGCTG
CTGCTGCTGGCGCTCGGCGCGCTGGGCTGGACCGCCCTGCGCTCCGCGGCCACTGCGCGC
CTCTTTCGGCCCCTGGCGAAGCGGTGCTGCCTCCAGCCCAGAGATGCCGCCAAGATGCCC
GAGAGCGCTTGGAAGTTTCTCTTCTACCTGGGCAGCTGGAGCTACAGTGCCTACCTGCTG
TTTGGCACCGACTACCCCTTCTTCCATGACCCACCATCTGTCTTCTACGACTGGACGCCG
GGCATGGCAGTGCCACGGGACATTGCAGCCGCCTACCTGCTCCAGGGAAGCTTCTATGGC
CACTCCATCTACGCTACGCTATACATGGACACCTGGCGCAAGGACTCGGTGGTCATGCTG
CTCCACCACGTGGTCACTCTCATCCTCATCGTCTCCTCCTACGCCTTCCGGTACCACAAT
GTGGGCATCCTTGTGCTCTTCCTGCACGATATCAGTGACGTGCAGCTTGAGTTCACCAAG
CTCAACATTTACTTCAAGTCCCGCGGCGGCTCCTACCATCGGCTGCATGCCTTGGCAGCA
GACTTGGGCTGCCTCAGCTTCGGCTTCAGCTGGTTCTGGTTCCGCCTCTACTGGTTCCCG
CTCAAGGTCCTGTATGCCACCAGTCACTGCAGTCTGCGCACGGTGCCTGACATCCCCTTC
TACTTCTTCTTCAATGCGCTCCTGCTGCTGCTCACCCTTATGAACCTCTACTGGTTCCTG
TACATCGTGGCGTTTGCAGCCAAGGTGTTGACAGGCCAGGTGCACGAGCTGAAGGACCTG
CGGGAGTATGACACAGCCGAGGCCCAGAGCCTGAAGCCCAGCAAAGCCGAGAAGCCACTG
AGGAACGGCCTGGTGAAGGACAAGCGCTTCTGA
Protein Properties
Number of Residues 350
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>LAG1 longevity assurance homolog 1
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
GenBank ID Protein 11641421
UniProtKB/Swiss-Prot ID P27544
UniProtKB/Swiss-Prot Entry Name LASS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_021267.3
GeneCard ID LASS1
GenAtlas ID Not Available
HGNC ID HGNC:14253
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Lee SJ: Expression of growth/differentiation factor 1 in the nervous system: conservation of a bicistronic structure. Proc Natl Acad Sci U S A. 1991 May 15;88(10):4250-4. [PubMed:2034669 ]
  4. Jiang JC, Kirchman PA, Zagulski M, Hunt J, Jazwinski SM: Homologs of the yeast longevity gene LAG1 in Caenorhabditis elegans and human. Genome Res. 1998 Dec;8(12):1259-72. [PubMed:9872981 ]