You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02784
Secondary Accession Numbers
  • 8290
Name Membrane-bound transcription factor site-1 protease
Synonyms
  1. Endopeptidase S1P
  2. SKI-1
  3. Subtilisin/kexin-isozyme 1
Gene Name MBTPS1
Protein Type Unknown
Biological Properties
General Function Involved in serine-type endopeptidase activity
Specific Function Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His- Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
serine-type endopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Golgi apparatus membrane
  2. Endoplasmic reticulum membrane
  3. Single-pass type I membrane protein
  4. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16|16q24
SNPs MBTPS1
Gene Sequence
>3159 bp
ATGAAGCTTGTCAACATCTGGCTGCTTCTGCTCGTGGTTTTGCTCTGTGGGAAGAAACAT
CTGGGCGACAGACTGGAAAAGAAATCTTTTGAAAAGGCCCCATGCCCTGGCTGTTCCCAC
CTGACTTTGAAGGTGGAATTCTCATCAACAGTTGTGGAATATGAATATATTGTGGCTTTC
AATGGATACTTTACAGCCAAAGCTAGAAATTCATTTATTTCAAGTGCCCTGAAGAGCAGT
GAAGTAGACAATTGGAGAATTATACCTCGAAACAATCCATCCAGTGACTACCCTAGTGAT
TTTGAGGTGATTCAGATAAAAGAAAAACAGAAAGCGGGGCTGCTAACACTTGAAGATCAT
CCAAACATCAAACGGGTCACGCCCCAACGAAAAGTCTTTCGTTCCCTCAAGTATGCTGAA
TCTGACCCCACAGTACCCTGCAATGAAACCCGGTGGAGCCAGAAGTGGCAATCATCACGT
CCCCTGCGAAGAGCCAGCCTCTCCCTGGGCTCTGGCTTCTGGCATGCTACGGGAAGGCAT
TCGAGCAGACGGCTGCTGAGAGCCATCCCGCGCCAGGTTGCCCAGACACTGCAGGCAGAT
GTGCTCTGGCAGATGGGATATACAGGTGCTAATGTAAGAGTTGCTGTTTTTGACACTGGG
CTGAGCGAGAAGCATCCCCACTTCAAAAATGTGAAGGAGAGAACCAACTGGACCAACGAG
CGAACGCTGGACGATGGGTTGGGCCATGGCACATTCGTGGCAGGTGTGATAGCCAGCATG
AGGGAGTGCCAAGGATTTGCTCCAGATGCAGAACTTCACATTTTCAGGGTCTTTACCAAT
AATCAGGTATCTTACACATCTTGGTTTTTGGACGCCTTCAACTATGCCATTTTAAAGAAG
ATCGACGTGTTAAACCTCAGCATCGGCGGCCCGGACTTCATGGATCATCCGTTTGTTGAC
AAGGTGTGGGAATTAACAGCTAACAATGTAATCATGGTTTCTGCTATTGGCAATGACGGA
CCTCTTTATGGCACTCTGAATAACCCTGCTGATCAAATGGATGTGATTGGAGTAGGCGGC
ATTGACTTTGAAGATAACATCGCCCGCTTTTCTTCAAGGGGAATGACTACCTGGGAGCTA
CCAGGAGGCTACGGTCGCATGAAACCTGACATTGTCACCTATGGTGCTGGCGTGCGGGGT
TCTGGCGTGAAAGGGGGGTGCCGGGCCCTCTCAGGGACCAGTGTTGCTTCTCCAGTGGTT
GCAGGTGCTGTCACCTTGTTAGTGAGCACAGTCCAGAAGCGTGAGCTGGTGAATCCCGCC
AGTATGAAGCAGGCCCTGATCGCGTCAGCCCGGAGGCTCCCCGGGGTCAACATGTTTGAG
CAAGGCCACGGCAAGCTCGATCTGCTCAGAGCCTATCAGATCCTCAACAGCTACAAGCCA
CAGGCAAGTTTGAGCCCCAGCTACATAGATCTGACTGAGTGTCCCTACATGTGGCCCTAC
TGCTCCCAGCCCATCTACTATGGAGGAATGCCGACAGTTGTTAATGTCACCATCCTCAAC
GGCATGGGAGTCACAGGAAGAATTGTAGATAAGCCTGACTGGCAGCCCTATTTGCCACAG
AACGGAGACAACATTGAAGTTGCCTTCTCCTACTCCTCGGTCTTATGGCCTTGGTCGGGC
TACCTGGCCATCTCCATTTCTGTGACCAAGAAAGCGGCTTCCTGGGAAGGCATTGCTCAG
GGCCATGTCATGATCACTGTGGCTTCCCCAGCAGAGACAGAGTCAAAAAATGGTGCAGAA
CAGACTTCAACAGTAAAGCTCCCCATTAAGGTGAAGATAATTCCTACTCCCCCGCGAAGC
AAGAGAGTTCTCTGGGATCAGTACCACAACCTCCGCTATCCACCTGGCTATTTCCCCAGG
GATAATTTAAGGATGAAGAATGACCCTTTAGACTGGAATGGTGATCACATCCACACCAAT
TTCAGGGATATGTACCAGCATCTGAGAAGCATGGGCTACTTTGTAGAGGTCCTCGGGGCC
CCCTTCACGTGTTTTGATGCCAGTCAGTATGGCACTTTGCTGATGGTGGACAGTGAGGAG
GAGTACTTCCCTGAAGAGATCGCCAAGCTCCGGAGGGACGTGGACAACGGCCTCTCGCTC
GTCATCTTCAGTGACTGGTACAACACTTCTGTTATGAGAAAAGTGAAGTTTTATGATGAA
AACACAAGGCAGTGGTGGATGCCGGATACCGGAGGAGCTAACATCCCAGCTCTGAATGAG
CTGCTGTCTGTGTGGAACATGGGGTTCAGCGATGGCCTGTATGAAGGGGAGTTCACCCTG
GCCAACCATGACATGTATTATGCGTCAGGGTGCAGCATCGCGAAGTTTCCAGAAGATGGC
GTCGTGATAACACAGACTTTCAAGGACCAAGGATTGGAGGTTTTAAAGCAGGAAACAGCA
GTTGTTGAAAACGTCCCCATTTTGGGACTTTATCAGATTCCAGCTGAGGGTGGAGGCCGG
ATTGTACTGTATGGGGACTCCAATTGCTTGGATGACAGTCACCGACAGAAGGACTGCTTT
TGGCTTCTGGATGCCCTCCTCCAGTACACATCGTATGGGGTGACACCGCCTAGCCTCAGT
CACTCTGGGAACCGCCAGCGCCCTCCCAGTGGAGCAGGCTCAGTCACTCCAGAGAGGATG
GAAGGAAACCATCTTCATCGGTACTCCAAGGTTCTGGAGGCCCATTTGGGAGACCCAAAA
CCTCGGCCTCTACCAGCCTGTCCACGCTTGTCTTGGGCCAAGCCACAGCCTTTAAACGAG
ACGGCGCCCAGTAACCTTTGGAAACATCAGAAGCTACTCTCCATTGACCTGGACAAGGTG
GTGTTACCCAACTTTCGATCGAATCGCCCTCAAGTGAGGCCCTTGTCCCCTGGAGAGAGC
GGCGCCTGGGACATTCCTGGAGGGATCATGCCTGGCCGCTACAACCAGGAGGTGGGCCAG
ACCATTCCTGTCTTTGCCTTCCTGGGAGCCATGGTGGTCCTGGCCTTCTTTGTGGTACAA
ATCAACAAGGCCAAGAGCAGGCCGAAGCGGAGGAAGCCCAGGGTGAAGCGCCCGCAGCTC
ATGCAGCAGGTTCACCCGCCAAAGACCCCTTCGGTGTGA
Protein Properties
Number of Residues 1052
Molecular Weight 117747.7
Theoretical pI 8.98
Pfam Domain Function
Signals
  • 1-17
Transmembrane Regions
  • 999-1021
Protein Sequence
>Membrane-bound transcription factor site-1 protease
MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAF
NGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDH
PNIKRVTPQRKVFRSLKYAESDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRH
SSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNE
RTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKK
IDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGG
IDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKP
QASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQ
NGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAE
QTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHIHTN
FRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSL
VIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGEFTL
ANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERM
EGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKV
VLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQ
INKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV
GenBank ID Protein 4506775
UniProtKB/Swiss-Prot ID Q14703
UniProtKB/Swiss-Prot Entry Name MBTP1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003791.2
GeneCard ID MBTPS1
GenAtlas ID MBTPS1
HGNC ID HGNC:15456
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Nagase T, Miyajima N, Tanaka A, Sazuka T, Seki N, Sato S, Tabata S, Ishikawa K, Kawarabayasi Y, Kotani H, et al.: Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995;2(1):37-43. [PubMed:7788527 ]
  5. Nakajima T, Iwaki K, Kodama T, Inazawa J, Emi M: Genomic structure and chromosomal mapping of the human site-1 protease (S1P) gene. J Hum Genet. 2000;45(4):212-7. [PubMed:10944850 ]
  6. Toure BB, Munzer JS, Basak A, Benjannet S, Rochemont J, Lazure C, Chretien M, Seidah NG: Biosynthesis and enzymatic characterization of human SKI-1/S1P and the processing of its inhibitory prosegment. J Biol Chem. 2000 Jan 28;275(4):2349-58. [PubMed:10644685 ]
  7. Seidah NG, Mowla SJ, Hamelin J, Mamarbachi AM, Benjannet S, Toure BB, Basak A, Munzer JS, Marcinkiewicz J, Zhong M, Barale JC, Lazure C, Murphy RA, Chretien M, Marcinkiewicz M: Mammalian subtilisin/kexin isozyme SKI-1: A widely expressed proprotein convertase with a unique cleavage specificity and cellular localization. Proc Natl Acad Sci U S A. 1999 Feb 16;96(4):1321-6. [PubMed:9990022 ]