Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02808
Secondary Accession Numbers
  • 8314
Name Cytochrome b5
Synonyms
  1. MCB5
  2. Microsomal cytochrome b5 type A
Gene Name CYB5A
Protein Type Unknown
Biological Properties
General Function Involved in heme binding
Specific Function Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
heme binding
Cellular Location
  1. Isoform 2:Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 18q23
SNPs CYB5A
Gene Sequence
>405 bp
ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCAC
AACCACAGCAAGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTT
CTGGAAGAGCATCCTGGTGGGGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACT
GAGAACTTTGAGGATGTCGGGCACTCTACAGATGCCAGGGAAATGTCCAAAACATTCATC
ATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACAAGCCTCCGGAAACTCTTATC
ACTACTATTGATTCTAGTTCCAGTTGGTGGACCAACTGGGTGATCCCTGCCATCTCTGCA
GTGGCCGTCGCCTTGATGTATCGCCTATACATGGCAGAGGACTGA
Protein Properties
Number of Residues 134
Molecular Weight 15330.0
Theoretical pI 4.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 109-131
Protein Sequence
>Cytochrome b5
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P00167
UniProtKB/Swiss-Prot Entry Name CYB5_HUMAN
PDB IDs
GenBank Gene ID M22865
GeneCard ID CYB5A
GenAtlas ID CYB5A
HGNC ID HGNC:2570
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  3. Yoo M, Steggles AW: The complete nucleotide sequence of human liver cytochrome b5 mRNA. Biochem Biophys Res Commun. 1988 Oct 14;156(1):576-80. [PubMed:3178851 ]
  4. Giordano SJ, Steggles AW: The human liver and reticulocyte cytochrome b5 mRNAs are products from a single gene. Biochem Biophys Res Commun. 1991 Jul 15;178(1):38-44. [PubMed:1712589 ]
  5. Li XR, Giordano SJ, Yoo M, Steggles AW: The isolation and characterization of the human cytochrome b5 gene. Biochem Biophys Res Commun. 1995 Apr 26;209(3):894-900. [PubMed:7733981 ]
  6. Abe K, Kimura S, Kizawa R, Anan FK, Sugita Y: Amino acid sequences of cytochrome b5 from human, porcine, and bovine erythrocytes and comparison with liver microsomal cytochrome b5. J Biochem. 1985 Jun;97(6):1659-68. [PubMed:4030743 ]
  7. Nobrega FG, Ozols J: Amino acid sequences of tryptic peptides of cytochromes b5 from microsomes of human, monkey, porcine, and chicken liver. J Biol Chem. 1971 Mar 25;246(6):1706-17. [PubMed:4993957 ]
  8. Ozols J: Cytochrome b 5 from a normal human liver. Isolation and the partial amino acid sequence. J Biol Chem. 1972 Apr 10;247(7):2242-5. [PubMed:5062820 ]
  9. Rashid MA, Hagihara B, Kobayashi M, Tani S, Tsugita A: Structural studies of cytochrome b5. 3. Sequential studies on human liver cytochrome b5. J Biochem. 1973 Nov;74(5):985-1002. [PubMed:4770377 ]
  10. Ozols J: Structure of cytochrome b5 and its topology in the microsomal membrane. Biochim Biophys Acta. 1989 Jul 27;997(1-2):121-30. [PubMed:2752049 ]
  11. Giordano SJ, Kaftory A, Steggles AW: A splicing mutation in the cytochrome b5 gene from a patient with congenital methemoglobinemia and pseudohermaphrodism. Hum Genet. 1994 May;93(5):568-70. [PubMed:8168836 ]