Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02818
Secondary Accession Numbers
  • 8324
Name Sodium/hydrogen exchanger 3
Synonyms
  1. NHE-3
  2. Na(+)/H(+) exchanger 3
  3. Solute carrier family 9 member 3
Gene Name SLC9A3
Protein Type Unknown
Biological Properties
General Function Involved in solute:hydrogen antiporter activity
Specific Function Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
monovalent cation:hydrogen antiporter activity
sodium:hydrogen antiporter activity
solute:cation antiporter activity
solute:hydrogen antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
cation homeostasis
monovalent inorganic cation homeostasis
regulation of ph
sodium ion transport
establishment of localization
transport
biological regulation
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5p15.3
SNPs SLC9A3
Gene Sequence
>2505 bp
ATGTGGGGACTCGGGGCCCGGGGCCCCGACCGGGGGCTGCTGCTGGCGCTGGCGCTGGGC
GGGCTGGCGCGGGCCGGGGGCGTCGAGGTGGAGCCCGGCGGCGCGCACGGCGAGAGCGGG
GGCTTCCAGGTGGTCACCTTCGAGTGGGCCCACGTGCAGGATCCCTACGTCATCGCGCTC
TGGATCCTCGTGGCCAGCTTGGCCAAGATCGGGTTCCACCTGTCCCACAAGGTCACCAGC
GTGGTTCCCGAGAGCGCCCTGCTCATCGTGCTGGGCCTGGTGCTGGGCGGCATCGTCTGG
GCGGCCGACCACATCGCGTCCTTCACACTGACGCCCACCGTCTTCTTCTTCTACCTGCTG
CCCCCCATCGTGCTGGACGCCGGCTACTTCATGCCCAACCGCCTCTTCTTCGGCAACCTG
GGGACCATCCTGTTGTACGCCGTCGTGGGTACCGTGTGGAACGCGGCCACCACCGGGCTG
TCCCTCTACGGCGTCTTCCTCAGTGGGCTCATGGGCGACCTGCAGATTGGGCTGCTGGAC
TTCCTCCTGTTTGGCAGCCTCATGGCGGCTGTGGACCCGGTGGCCGTCCTGGCCGTGTTT
GAGGAGGTCCATGTCAACGAGGTCCTGTTCATCATCGTCTTCGGGGAGTCGCTGCTGAAC
GACGCAGTCACCGTGGTTCTGTACAATGTGTTTGAATCTTTCGTGGCGCTGGGAGGTGAC
AACGTGACTGGCGTGGACTGCGTGAAGGGCATAGTGTCCTTCTTCGTGGTGAGCCTGGGG
GGCACGCTGGTGGGGGTGGTCTTCGCCTTCCTGCTGTCGCTGGTGACGCGCTTCACCAAG
CATGTGCGTATCATCGAGCCCGGCTTCGTGTTCATCATCTCCTACCTGTCCTACCTGACG
TCCGAGATGCTGTCGCTGTCGGCCATCCTCGCCATCACCTTCTGTGGCATCTGCTGTCAG
AAGTATGTGAAGGCCAACATCTCGGAGCAGTCGGCCACCACCGTGCGCTACACCATGAAG
ATGCTGGCCAGCAGCGCCGAGACCATCATCTTCATGTTCCTGGGTATCTCGGCCGTGAAC
CCGTTCATCTGGACCTGGAACACGGCCTTCGTGCTCCTGACGCTGGTCTTCATCTCCGTG
TACCGGGCCATCGGTGTGGTCCTGCAGACCTGGCTTCTGAACCGCTACCGCATGGTGCAG
CTGGAGCCCATTGACCAGGTGGTCCTGTCCTACGGGGGCCTGCGCGGGGCCGTGGCCTTT
GCCCTGGTGGTGCTTCTGGATGGAGACAAGGTCAAGGAGAAGAACCTGTTCGTCAGCACC
ACCATCATCGTAGTGTTCTTCACCGTCATCTTCCAGGGCCTGACCATCAAGCCTCTGGTG
CAGTGGCTGAAGGTGAAGAGGAGCGAGCACCGGGAACCTCGGCTCAACGAGAAGCTGCAC
GGGCGCGCTTTCGACCACATCCTCTCGGCCATCGAGGACATATCCGGACAGATCGGGCAC
AATTATCTCAGAGACAAGTGGTCCCACTTCGACAGGAAGTTCCTCAGCAGGGTCCTCATG
AGACGGTCGGCCCAGAAGTCTCGAGACCGGATCCTGAATGTCTTCCACGAGCTGAACCTG
AAGGATGCCATCAGCTACGTGGCTGAGGGAGAGCGCCGCGGGTCCCTGGCCTTCATCCGC
TCCCCCAGCACCGACAACGTGGTCAACGTGGACTTCACGCCACGATCGTCCACCGTGGAG
GCCTCTGTCTCCTACCTCCTGAGAGAAAATGTCAGCGCTGTCTGCCTGGACATGCAGTCT
CTGGAGCAGCGACGGCGGAGCATCCGGGACGCGGAGGACATGGTCACGCACCACACGCTA
CAGCAGTACCTGTACAAGCCGCGGCAGGAGTACAAGCATCTGTACAGCCGACACGAGCTC
ACGCCCACGGAGGACGAGAAACAGGACCGGGAAATCTTCCACAGGACCATGCGGAAGCGC
CTGGAGTCCTTCAAGTCGACCAAGCTGGGGCTCAACCAGAACAAGAAGGCGGCCAAGCTG
TACAAGCGGGAGCGTGCCCAGAAGCGGAGAAACAGCAGCATCCCCAATGGGAAGCTGCCC
ATGGAGAGCCCTGCGCAGAATTTCACCATCAAGGAGAAAGACTTGGAACTTTCAGACACC
GAGGAGCCCCCCAACTATGATGAGGAGATGAGTGGGGGGATCGAGTTCCTGGCTAGTGTC
ACCAAGGACACAGCGTCCGACTCCCCTGCAGGAATTGACAACCCTGTGTTTTCTCCGGAC
GAGGCCCTGGACCGCAGCCTCCTGGCCAGGCTGCCGCCCTGGCTGTCTCCCGGGGAGACG
GTGGTCCCCTCGCAGAGGGCCCGCACGCAGATTCCCTACTCTCCCGGCACCTTCTGCCGC
CTGATGCCCTTCCGCCTCAGCAGCAAGTCCGTGGACTCCTTCCTGCAGGCAGACGGCCCC
GAGGAGCGGCCCCCCGCCGCCCTCCCCGAGTCCACACACATGTGA
Protein Properties
Number of Residues 834
Molecular Weight 92853.7
Theoretical pI 7.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 80-99
  • 113-133
  • 140-160
  • 181-202
  • 211-232
  • 253-274
  • 291-309
  • 341-362
  • 370-390
  • 436-456
Protein Sequence
>Sodium/hydrogen exchanger 3
MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIAL
WILVASLAKIGFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLL
PPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLD
FLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGD
NVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLT
SEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVN
PFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAF
ALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLH
GRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNL
KDAISYVAEGERRGSLAFIRSPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQS
LEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
LESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDT
EEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGET
VVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM
GenBank ID Protein 194239733
UniProtKB/Swiss-Prot ID P48764
UniProtKB/Swiss-Prot Entry Name SL9A3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004174.2
GeneCard ID SLC9A3
GenAtlas ID SLC9A3
HGNC ID HGNC:11073
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  3. Brant SR, Yun CH, Donowitz M, Tse CM: Cloning, tissue distribution, and functional analysis of the human Na+/N+ exchanger isoform, NHE3. Am J Physiol. 1995 Jul;269(1 Pt 1):C198-206. [PubMed:7631746 ]
  4. Zachos NC, Hodson C, Kovbasnjuk O, Li X, Thelin WR, Cha B, Milgram S, Donowitz M: Elevated intracellular calcium stimulates NHE3 activity by an IKEPP (NHERF4) dependent mechanism. Cell Physiol Biochem. 2008;22(5-6):693-704. doi: 10.1159/000185553. Epub 2008 Dec 9. [PubMed:19088451 ]