Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02819
Secondary Accession Numbers
  • 8325
Name Asialoglycoprotein receptor 2
Synonyms
  1. ASGP-R 2
  2. ASGPR 2
  3. C-type lectin domain family 4 member H2
  4. HL-2
  5. Hepatic lectin H2
Gene Name ASGR2
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17p
SNPs ASGR2
Gene Sequence
>936 bp
ATGGCCAAGGACTTTCAAGATATCCAGCAGCTGAGCTCGGAGGAAAATGACCATCCTTTC
CATCAAGGTGAGGGGCCAGGCACTCGCAGGCTGAATCCCAGGAGAGGAAATCCATTTTTG
AAAGGGCCACCTCCTGCCCAGCCCCTGGCACAGCGTCTCTGCTCCATGGTCTGCTTCAGT
CTGCTTGCCCTGAGCTTCAACATCCTGCTGCTGGTGGTCATCTGTGTGACTGGGTCCCAA
AGTGAGGGTCACAGAGGTGCACAGCTGCAAGCCGAGCTGCGGAGCCTGAAGGAAGCTTTC
AGCAACTTCTCCTCGAGCACCCTGACGGAGGTCCAGGCAATCAGCACCCACGGAGGCAGC
GTGGGTGACAAGATCACATCCCTAGGAGCCAAGCTGGAGAAACAGCAGCAGGACCTGAAA
GCAGATCACGATGCCCTGCTCTTCCATCTGAAGCACTTCCCCGTGGACCTGCGCTTCGTG
GCCTGCCAGATGGAGCTCCTCCACAGCAACGGCTCCCAAAGGACCTGCTGCCCCGTCAAC
TGGGTGGAGCACCAAGGCAGCTGCTACTGGTTCTCTCACTCCGGGAAGGCCTGGGCTGAG
GCGGAGAAGTACTGCCAGCTGGAGAACGCACACCTGGTGGTCATCAACTCCTGGGAGGAG
CAGAAATTCATTGTACAACACACGAACCCCTTCAATACCTGGATAGGTCTCACGGACAGT
GATGGCTCTTGGAAATGGGTGGATGGCACAGACTATAGGCACAACTACAAGAACTGGGCT
GTCACTCAGCCAGATAATTGGCACGGGCACGAGCTGGGTGGAAGTGAAGACTGTGTTGAA
GTCCAGCCGGATGGCCGCTGGAACGATGACTTCTGCCTGCAGGTGTACCGCTGGGTGTGT
GAGAAAAGGCGGAATGCCACCGGCGAGGTGGCCTGA
Protein Properties
Number of Residues 311
Molecular Weight 35092.0
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 59-79
Protein Sequence
>Asialoglycoprotein receptor 2
MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFS
LLALSFNILLLVVICVTGSQSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGS
VGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVN
WVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDS
DGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVC
EKRRNATGEVA
GenBank ID Protein 179081
UniProtKB/Swiss-Prot ID P07307
UniProtKB/Swiss-Prot Entry Name ASGR2_HUMAN
PDB IDs Not Available
GenBank Gene ID M11025
GeneCard ID ASGR2
GenAtlas ID ASGR2
HGNC ID HGNC:743
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  5. Pan H, Qin WX, Huo KK, Wan DF, Yu Y, Xu ZG, Hu QD, Gu KT, Zhou XM, Jiang HQ, Zhang PP, Huang Y, Li YY, Gu JR: Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1. Genomics. 2001 Sep;77(1-2):58-64. [PubMed:11543633 ]
  6. Spiess M, Lodish HF: Sequence of a second human asialoglycoprotein receptor: conservation of two receptor genes during evolution. Proc Natl Acad Sci U S A. 1985 Oct;82(19):6465-9. [PubMed:3863106 ]
  7. Paietta E, Stockert RJ, Racevskis J: Differences in the abundance of variably spliced transcripts for the second asialoglycoprotein receptor polypeptide, H2, in normal and transformed human liver. Hepatology. 1992 Mar;15(3):395-402. [PubMed:1371982 ]